FXR/NR1H4 Antibody

Images

 
Western Blot: FXR Antibody [NBP1-52830] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related FXR/NR1H4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52830
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FXR/NR1H4 Antibody Summary

Immunogen
Synthetic peptides corresponding to NR1H4(nuclear receptor subfamily 1, group H, member 4) The peptide sequence was selected from the middle region of NR1H4. Peptide sequence SAVEAMFLRSAEIFNKKLPSGHSDLLEERIRNSGISDEYITPMFSFYKSI.
Clonality
Polyclonal
Host
Rabbit
Gene
NR1H4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against NR1H4 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FXR/NR1H4 Antibody

  • BAR
  • bile acid receptor
  • farnesoid X receptor
  • Farnesoid X-activated receptor
  • Farnesol receptor HRR-1
  • FXR
  • FXRBAR
  • HRR-1
  • HRR1MGC163445
  • NR1H4
  • Nuclear receptor subfamily 1 group H member 4
  • nuclear receptor subfamily 1, group H, member 4
  • Retinoid X receptor-interacting protein 14
  • RIP14
  • RIP14RXR-interacting protein 14

Background

NR1H4 is the receptor for bile acids such as chenodeoxycholic acid, lithocholic acid and deoxycholic acid. NR1H4 represses the transcription of the cholesterol 7-alpha-hydroxylase gene (CYP7A1) through the induction of NR0B2 or FGF19 expression, via two d

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-46522
Species: Hu
Applications: WB, IHC
MAB9120
Species: Hu
Applications: ICC
NBP1-31824
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-23669
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB400-157
Species: Hu, Mu, Po, Pm
Applications: WB, Simple Western
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-27196
Species: Hu, Mu, Bv, Ca, Ch, ChHa, Eq, GP, Other, Pm
Applications: WB, IHC-P
NBP1-37003
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB120-19347
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IF
NBP1-47935
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01860
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-35013
Species: Hu

Publications for FXR/NR1H4 Antibody (NBP1-52830) (0)

There are no publications for FXR/NR1H4 Antibody (NBP1-52830).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FXR/NR1H4 Antibody (NBP1-52830) (0)

There are no reviews for FXR/NR1H4 Antibody (NBP1-52830). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FXR/NR1H4 Antibody (NBP1-52830) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FXR/NR1H4 Products

Bioinformatics Tool for FXR/NR1H4 Antibody (NBP1-52830)

Discover related pathways, diseases and genes to FXR/NR1H4 Antibody (NBP1-52830). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FXR/NR1H4 Antibody (NBP1-52830)

Discover more about diseases related to FXR/NR1H4 Antibody (NBP1-52830).
 

Pathways for FXR/NR1H4 Antibody (NBP1-52830)

View related products by pathway.

PTMs for FXR/NR1H4 Antibody (NBP1-52830)

Learn more about PTMs related to FXR/NR1H4 Antibody (NBP1-52830).
 

Research Areas for FXR/NR1H4 Antibody (NBP1-52830)

Find related products by research area.

Blogs on FXR/NR1H4

There are no specific blogs for FXR/NR1H4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FXR/NR1H4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NR1H4
Entrez
Uniprot