Recombinant Human FUT9 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related FUT9 Peptides and Proteins

Order Details


    • Catalog Number
      H00010690-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human FUT9 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-359 of Human FUT9 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MTSTSKGILRPFLIVCIILGCFMACLLIYIKPTNSWIFSPMESASSVLKMKNFFSTKTDYFNETTILVWVWPFGQTFDLTSCQAMFNIQGCHLTTDRSLYNKSHAVLIHHRDISWDLTNLPQQARPPFQKWIWMNLESPTHTPQKSGIEHLFNLTLTYRRDSDIQVPYGFLTVSTNPFVFEVPSKEKLVCWVVSNWNPEHARVKYYNELSKSIEIHTYGQAFGEYVNDKNLIPTISACKFYLSFENSIHKDYITEKLYNAFLAGSVPVVLGPSRENYENYIPADSFIHVEDYNSPSELAKYLKEVDKNNKLYLSYFNWRKDFTVNLPRFWESHACLACDHVKRHQEYKSVGNLEKWFWN

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
FUT9

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FUT9 Protein

  • Alpha-(1,3)-Fucosyltransferase 9
  • alpha-(1,3)-fucosyltransferase
  • EC 2.4.1
  • EC 2.4.1.-
  • EC 2.4.1.65
  • fucosyltransferase 9 (alpha (1,3) fucosyltransferase)
  • Fucosyltransferase 9
  • Fucosyltransferase IX
  • FucT-IX
  • Fuc-TIXFucT-IX
  • FUT9
  • Galactoside 3-L-fucosyltransferase

Background

FUT9 is one of several alpha-3-fucosyltransferases that can catalyze the last step in the biosynthesis of Lewis antigen, the addition of a fucose to precursor polysaccharides. FUT9 synthesizes the LeX oligosaccharide (CD15), which is expressed in organ buds progressing in mesenchyma during human embryogenesis.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB64091
Species: Hu
Applications: WB, ICC
NBP2-55006
Species: Hu
Applications: ICC/IF
4949-GT
Species: Hu
NB120-19294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF5924
Species: Hu
Applications: WB, Simple Western
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB161
Species: Hu
Applications: WB, Flow, IHC, AdBlk, CyTOF-ready, ICC
H00009768-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83132
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010690-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for FUT9 Recombinant Protein (H00010690-P01) (0)

There are no publications for FUT9 Recombinant Protein (H00010690-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUT9 Recombinant Protein (H00010690-P01) (0)

There are no reviews for FUT9 Recombinant Protein (H00010690-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FUT9 Recombinant Protein (H00010690-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FUT9 Products

Bioinformatics Tool for FUT9 Recombinant Protein (H00010690-P01)

Discover related pathways, diseases and genes to FUT9 Recombinant Protein (H00010690-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUT9 Recombinant Protein (H00010690-P01)

Discover more about diseases related to FUT9 Recombinant Protein (H00010690-P01).
 

Pathways for FUT9 Recombinant Protein (H00010690-P01)

View related products by pathway.

PTMs for FUT9 Recombinant Protein (H00010690-P01)

Learn more about PTMs related to FUT9 Recombinant Protein (H00010690-P01).

Blogs on FUT9

There are no specific blogs for FUT9, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FUT9 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FUT9
Entrez