FUS2 Antibody - Azide and BSA Free

Western Blot: FUS2 Antibody [H00024142-D01P] - Analysis of NAT6 expression in mouse testis.

Western Blot: FUS2 Antibody [H00024142-D01P] - Analysis of NAT6 expression in PC-12.

Western Blot: FUS2 Antibody [H00024142-D01P] - Analysis of NAT6 expression in Raw 264.7.

Western Blot: FUS2 Antibody [H00024142-D01P] - Analysis of NAT6 expression in A-431.

Western Blot: FUS2 Antibody [H00024142-D01P] - Analysis of NAT6 expression in human kidney.

Western Blot: FUS2 Antibody [H00024142-D01P] - Analysis of NAT6 expression in transfected 293T cell line by NAT6 polyclonal antibody.Lane 1: NAT6 transfected lysate(33.80 KDa).Lane 2: Non-transfected lysate.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

FUS2 Antibody - Azide and BSA Free Summary

• Immunogen: NAT6 (NP_036323.2, 1 a.a. - 308 a.a.) full-length human protein. MQELTLSPGPAKLTPTLDPTHRMELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAELTLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVVVGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQVHFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPPLPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NAA80
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FUS2 Antibody - Azide and BSA Free

• FUS-2
• FUS2EC 2.3.1.-
• N-acetyltransferase 6 (GCN5-related)
• N-acetyltransferase 6
• Protein fus-2
• Protein fusion-2

Background

Vertebrate FUS2 genes, which are known to be putative tumor suppressor gene, contain several important domains such as the catalytic N-acetyltransferase (NAT) domain. NAT domain is essential enzymes involved in several sophisticated cellular processes such as N-acetylation, O-acetylatin. NAT enzymes may be involved in susceptibility to cancer including colorectal cancer because of the presence of carcinogenic heterocyclic amines in some cooked foods. FUS2 was physically localized to the cytoplasm. Also, FUS2 showed the actin dependent movement, closely related to the polarization in the budding yeast, Saccharomyces cerevisiae.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: NAA80
• Uniprot:
  • NP_036323.2(Human)