FUCA2 Antibody

Images

 
Immunohistochemistry: FUCA2 Antibody [NBP1-85190] - Staining of human kidney shows distinct cytoplasmic positivity with a granular pattern in tubule cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FUCA2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:AGSICKHGGFYTCSDRYNPGHLLPHKWENCMTIDKLSWGYRREAGISDYLTIEELVKQLV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FUCA2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FUCA2 Protein (NBP1-85190PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FUCA2 Antibody

  • Alpha-L-fucosidase 2
  • Alpha-L-fucoside fucohydrolase 2
  • dJ20N2.5
  • EC 3.2.1.51
  • fucosidase, alpha-L- 2, plasma
  • MGC1314
  • plasma alpha-L-fucosidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
MAB1368
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICC, ICFlow, KO
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF8537
Species: Mu, Rt
Applications: WB, Simple Western, ICC
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-81782
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8238
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-19015
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, ICC/IF, IP
AF6278
Species: Hu, Mu
Applications: WB
MAB3694
Species: Hu
Applications: WB, IHC
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF2030
Species: Hu
Applications: WB, IHC
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready

Publications for FUCA2 Antibody (NBP1-85190) (0)

There are no publications for FUCA2 Antibody (NBP1-85190).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUCA2 Antibody (NBP1-85190) (0)

There are no reviews for FUCA2 Antibody (NBP1-85190). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FUCA2 Antibody (NBP1-85190) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FUCA2 Products

Bioinformatics Tool for FUCA2 Antibody (NBP1-85190)

Discover related pathways, diseases and genes to FUCA2 Antibody (NBP1-85190). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUCA2 Antibody (NBP1-85190)

Discover more about diseases related to FUCA2 Antibody (NBP1-85190).
 

Pathways for FUCA2 Antibody (NBP1-85190)

View related products by pathway.

Blogs on FUCA2

There are no specific blogs for FUCA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FUCA2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FUCA2