FUBP1 Antibody (3H4) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related FUBP1 Primary Antibodies

Order Details


    • Catalog Number
      H00008880-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FUBP1 Antibody (3H4) [PerCP] Summary

Immunogen
FUBP1 (NP_003893, 27 a.a. - 136 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQI
Marker
Nucleus without Nucleoli Marker
Specificity
FUBP1 - far upstream element (FUSE) binding protein 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FUBP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FUBP1 Antibody (3H4) [PerCP]

  • far upstream element (FUSE) binding protein 1
  • far upstream element binding protein
  • far upstream element-binding protein 1
  • FBPDNA helicase V
  • FUBP
  • FUSE-binding protein 1
  • hDH V

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB5646
Species: Hu
Applications: WB, Flow, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-33950
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF842
Species: Hu
Applications: WB
MAB3428
Species: Hu
Applications: WB, IHC
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP2-43835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84721
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-33137
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-84680
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-57033
Species: Hu
Applications: WB
AF6517
Species: Hu
Applications: WB
NB100-40840
Species: Hu, Mu
Applications: WB, IHC-P, IP
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P

Publications for FUBP1 Antibody (H00008880-M01PCP) (0)

There are no publications for FUBP1 Antibody (H00008880-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FUBP1 Antibody (H00008880-M01PCP) (0)

There are no reviews for FUBP1 Antibody (H00008880-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FUBP1 Antibody (H00008880-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FUBP1 Products

Bioinformatics Tool for FUBP1 Antibody (H00008880-M01PCP)

Discover related pathways, diseases and genes to FUBP1 Antibody (H00008880-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FUBP1 Antibody (H00008880-M01PCP)

Discover more about diseases related to FUBP1 Antibody (H00008880-M01PCP).
 

Pathways for FUBP1 Antibody (H00008880-M01PCP)

View related products by pathway.

PTMs for FUBP1 Antibody (H00008880-M01PCP)

Learn more about PTMs related to FUBP1 Antibody (H00008880-M01PCP).

Blogs on FUBP1

There are no specific blogs for FUBP1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FUBP1 Antibody (3H4) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol FUBP1