FSD1 Antibody

Images

 
Western Blot: FSD1 Antibody [NBP3-10100] - Western blot analysis of FSD1 in Human 293T Whole Cell lysates. Antibody dilution at 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FSD1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human FSD1 (NP_077309.1). Peptide sequence SPARGTPSPKRMPSGRGGRDRFTAESYTVLGDTLIDGGEHYWEVRYEPDS
Clonality
Polyclonal
Host
Rabbit
Gene
FSD1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for FSD1 Antibody

  • fibronectin type 3 and SPRY domain containing 1
  • fibronectin type III and SPRY domain containing 1
  • fibronectin type III and SPRY domain-containing protein 1
  • GLFNDfibronectin type 3 and SPRY (spla, ryanodine) domain containing (withcoiled-coil motif) 1
  • MGC3213
  • Microtubule-associated protein GLFND
  • midline 1-related protein 1
  • MIR1MID1-related protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88606
Species: Hu
Applications: IHC, IHC-P, Simple Western
NBP1-85540
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-46069
Species: Hu, Mu, Rt
Applications: WB
NBP2-85297
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-09505
Species: Hu
Applications: WB
NBP2-25208
Species: Hu, Mu, Rt
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
DDX0390P-100
Species: Hu, Mu
Applications: B/N, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vivo
788-G8/CF
Species: Hu, Mu, Rt
Applications: BA
796-IC
Species: Mu
Applications: BA
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89150
Species: Hu, Rt
Applications: IHC, IHC-P, WB
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
NBP2-15843
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-98549
Species: Hu
Applications: WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
DFN00
Species: Hu
Applications: ELISA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP2-21037
Species: Hu
Applications: IHC, IHC-P, WB
7268-CT
Species: Hu
Applications: BA

Publications for FSD1 Antibody (NBP3-10100) (0)

There are no publications for FSD1 Antibody (NBP3-10100).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FSD1 Antibody (NBP3-10100) (0)

There are no reviews for FSD1 Antibody (NBP3-10100). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FSD1 Antibody (NBP3-10100) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FSD1 Products

Bioinformatics Tool for FSD1 Antibody (NBP3-10100)

Discover related pathways, diseases and genes to FSD1 Antibody (NBP3-10100). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FSD1 Antibody (NBP3-10100)

Discover more about diseases related to FSD1 Antibody (NBP3-10100).
 

Pathways for FSD1 Antibody (NBP3-10100)

View related products by pathway.

PTMs for FSD1 Antibody (NBP3-10100)

Learn more about PTMs related to FSD1 Antibody (NBP3-10100).
 

Research Areas for FSD1 Antibody (NBP3-10100)

Find related products by research area.

Blogs on FSD1

There are no specific blogs for FSD1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FSD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FSD1