Frizzled-3 Antibody (2H5) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related Frizzled-3 Primary Antibodies

Order Details


    • Catalog Number
      H00007976-M09G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Frizzled-3 Antibody (2H5) [DyLight 488] Summary

Immunogen
FZD3 (NP_059108, 55 a.a. - 157 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAV
Specificity
FZD3 - frizzled homolog 3 (Drosophila)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FZD3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Frizzled-3 Antibody (2H5) [DyLight 488]

  • frizzled (Drosophila) homolog 3
  • frizzled homolog 3 (Drosophila)
  • Frizzled3
  • Frizzled-3
  • Fz-3
  • FZD3
  • hFz3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1120
Species: Mu
Applications: WB, IHC
AF1617
Species: Hu
Applications: WB
AF3149
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NLS5103
Species: Hu, Bv, Ca
Applications: IHC-P, ICC
NB100-1353
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF198
Species: Mu
Applications: WB, IHC
MAB194
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-23659
Species: Hu, Mu, Rt, Pm
Applications: WB
NB100-2439
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-33842
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-24493
Species: Hu, Mu, Bv, Ch, Eq, Op, Pm
Applications: WB
645-WN/CF
Species: Hu, Mu
AF7164
Species: Hu
Applications: WB
AF6278
Species: Hu, Mu
Applications: WB
AF1927
Species: Hu
Applications: WB, IP, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF4815
Species: Hu, Mu, Rt
Applications: WB, IHC
H00007976-M09G
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Frizzled-3 Antibody (H00007976-M09G) (0)

There are no publications for Frizzled-3 Antibody (H00007976-M09G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Frizzled-3 Antibody (H00007976-M09G) (0)

There are no reviews for Frizzled-3 Antibody (H00007976-M09G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Frizzled-3 Antibody (H00007976-M09G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Frizzled-3 Products

Bioinformatics Tool for Frizzled-3 Antibody (H00007976-M09G)

Discover related pathways, diseases and genes to Frizzled-3 Antibody (H00007976-M09G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Frizzled-3 Antibody (H00007976-M09G)

Discover more about diseases related to Frizzled-3 Antibody (H00007976-M09G).
 

Pathways for Frizzled-3 Antibody (H00007976-M09G)

View related products by pathway.

PTMs for Frizzled-3 Antibody (H00007976-M09G)

Learn more about PTMs related to Frizzled-3 Antibody (H00007976-M09G).
 

Research Areas for Frizzled-3 Antibody (H00007976-M09G)

Find related products by research area.

Blogs on Frizzled-3

There are no specific blogs for Frizzled-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Frizzled-3 Antibody (2H5) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol FZD3
Entrez