Frataxin Antibody - BSA Free

Immunohistochemistry-Paraffin: Frataxin Antibody [NBP2-57717] - Staining of human tonsil shows strong granular cytoplasmic positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: Frataxin Antibody [NBP2-57717] - Staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.

Immunohistochemistry-Paraffin: Frataxin Antibody [NBP2-57717] - Staining of human testis shows strong granular cytoplasmic positivity in cells in seminiferous ducts.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Frataxin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Frataxin Antibody - BSA Free (NBP2-57717) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RTDIDATCTPRRASSNQRGLNQIWNVKKQSVYLMNLRKSGTLGHPGSLDETTYERLAEETLDSLAEFFEDLADKPYTFEDYDV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FXN
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Frataxin Recombinant Protein Antigen (NBP2-57717PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Frataxin Antibody - BSA Free

• CyaY
• EC 1.16.3.1
• FA
• FARRmitochondrial
• frataxin
• Friedreich ataxia protein
• Friedreich ataxia
• Fxn
• X25MGC57199

Background

Frataxin encodes a mitochondrial protein which belongs to FRATAXIN family. The protein functions in regulating mitochondrial iron transport and respiration. The expansion of intronic trinucleotide repeat GAA results in Friedreich ataxia. Alternative splicing occurs at this locus and two transcript variants encoding distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: FXN