FPGT Antibody

Images

 

Product Details

Summary
Product Discontinued
View other related FPGT Primary Antibodies

Order Details


    • Catalog Number
      NBP2-49412
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FPGT Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids:HKPSIEKMYQFNAVCRPGNFCQQDFAGGDIADLKLDSDYVYTDSLFYMDHKSAKMLLAFYEKIGTLSCEIDAYGDFLQALGPGAT
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FPGT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FPGT Antibody

  • fucose-1-phosphate guanyltransferase
  • fucose-1-phosphate guanylyltransferase
  • GDP-beta-L-fucose pyrophosphorylase
  • GDP-L-fucose diphosphorylase
  • GDP-L-fucose pyrophosphorylase
  • GFPPEC 2.7.7.30

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-59130
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP, KD
NBP2-49410
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83357
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-83467
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P
H00051086-D01P
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-58268
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-44643
Species: Hu
Applications: Flow, ICC/IF, CyTOF-ready
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-49412
Species: Hu
Applications: IHC

Publications for FPGT Antibody (NBP2-49412) (0)

There are no publications for FPGT Antibody (NBP2-49412).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FPGT Antibody (NBP2-49412) (0)

There are no reviews for FPGT Antibody (NBP2-49412). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for FPGT Antibody (NBP2-49412) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FPGT Products

Bioinformatics Tool for FPGT Antibody (NBP2-49412)

Discover related pathways, diseases and genes to FPGT Antibody (NBP2-49412). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FPGT Antibody (NBP2-49412)

Discover more about diseases related to FPGT Antibody (NBP2-49412).
 

Pathways for FPGT Antibody (NBP2-49412)

View related products by pathway.

Blogs on FPGT

There are no specific blogs for FPGT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FPGT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FPGT