FOXO4 Antibody

Images

 
Western Blot: FOXO4 Antibody [NBP1-69225] - Titration: 0.2-1 ug/ml, Positive Control: Hela cell lysate.

Product Details

Summary
Product Discontinued
View other related FOXO4 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69225
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FOXO4 Antibody Summary

Immunogen
Synthetic peptides corresponding to FOXO4 (forkhead box O4) The peptide sequence was selected from the C terminal of FOXO4. Peptide sequence TPVLTPPTEAASQDRMPQDLDLDMYMENLECDMDNIISDLMDEGEGLDFN.
Clonality
Polyclonal
Host
Rabbit
Gene
FOXO4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FOXO4 and was validated on Western blot.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FOXO4 Antibody

  • AFX
  • AFX1myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 7
  • Fork head domain transcription factor AFX1
  • forkhead box O4
  • forkhead box protein O4
  • MLLT7MGC120490
  • myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 7

Background

FOXO4 is transcription factor involved in the regulation of the insulin signaling pathway. It binds to insulin-response elements (IREs) and can activate transcription of IGFBP1. The protein can down-regulate expression of HIF1A and suppress hypoxia-induced transcriptional activation of HIF1A-modulated genes. It is also involved in negative regulation of the cell cycle. A chromosomal aberration involving FOXO4 is found in acute leukemias.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1555
Species: Hu
Applications: WB
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB7557
Species: Hu
Applications: WB, IHC
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-91611
Species: Mu
Applications: WB
NBP1-97856
Species: Hu, Mu, Rt
Applications: WB
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-69225
Species: Hu
Applications: WB

Publications for FOXO4 Antibody (NBP1-69225) (0)

There are no publications for FOXO4 Antibody (NBP1-69225).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXO4 Antibody (NBP1-69225) (0)

There are no reviews for FOXO4 Antibody (NBP1-69225). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FOXO4 Antibody (NBP1-69225) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOXO4 Products

Bioinformatics Tool for FOXO4 Antibody (NBP1-69225)

Discover related pathways, diseases and genes to FOXO4 Antibody (NBP1-69225). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXO4 Antibody (NBP1-69225)

Discover more about diseases related to FOXO4 Antibody (NBP1-69225).
 

Pathways for FOXO4 Antibody (NBP1-69225)

View related products by pathway.

PTMs for FOXO4 Antibody (NBP1-69225)

Learn more about PTMs related to FOXO4 Antibody (NBP1-69225).
 

Research Areas for FOXO4 Antibody (NBP1-69225)

Find related products by research area.

Blogs on FOXO4.

The role of HIF-1 Alpha signaling in the retina under hypoxic conditions
Hypoxia inducible factor 1 (HIF-1) is a protein that plays an essential role in hypoxia, or low levels of cellular oxygen. HIF-1 is a heterodimeric protein that consists of a constitutively expressed beta subunit and oxygen related alpha subunit. ...  Read full blog post.

The Wise Old Fox: Forkhead Transcription Factors and Age-Related DAF-16 Studies
Orthologs are one of the classes of homolog genes. They occur in different species, but are linked by a common ancestral pathway. During evolution, they retain the same original function, irrespective of the species. Among the orthologs covered on our...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOXO4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXO4
Uniprot