FoxO1/FKHR Antibody (3A10)

Images

 
Western Blot: FoxO1/FKHR Antibody (3A10) [H00002308-M12] - Analysis of FOXO1A expression in SW-13 (Cat # L005V1).
Immunocytochemistry/ Immunofluorescence: FoxO1/FKHR Antibody (3A10) [H00002308-M12] - Analysis of monoclonal antibody to FOXO1 on HeLa cell. Antibody concentration 15 ug/ml
Immunohistochemistry-Paraffin: FoxO1/FKHR Antibody (3A10) [H00002308-M12] - Analysis of monoclonal antibody to FOXO1A on formalin-fixed paraffin-embedded human liver. Antibody concentration 3 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
3A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FoxO1/FKHR Antibody (3A10) Summary

Immunogen
FOXO1A (NP_002006 452 a.a. - 555 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSQYNCAPGLLKELLTSDSPPHNDIMTPVDPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLPHTVSTMPHTSGMNRL
Specificity
FOXO1A (3A10)
Isotype
IgG2a Lambda
Clonality
Monoclonal
Host
Mouse
Gene
FOXO1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has been used for ELISA and IHC-P.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxO1/FKHR Antibody (3A10)

  • FKH1
  • FKHR
  • FKHRforkhead box protein O1
  • forkhead box O1
  • Forkhead box protein O1A
  • forkhead homolog in rhabdomyosarcoma
  • Forkhead in rhabdomyosarcoma
  • FoxO1
  • FOXO1Aforkhead, Drosophila, homolog of, in rhabdomyosarcoma

Background

This gene belongs to the forkhead family of transcription factors which are characterized by a distinct forkhead domain. The specific function of this gene has not yet been determined; however, it may play a role in myogenic growth and differentiation. Translocation of this gene with PAX3 has been associated with alveolar rhabdomyosarcoma.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow
NBP2-45712
Species: Hu
Applications: WB, IHC
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
MAB1675
Species: Hu, Mu, Rt, Ch
Applications: ICC
AF1555
Species: Hu
Applications: WB
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP2-53088
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
H00002308-M12
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P

Publications for FoxO1/FKHR Antibody (H00002308-M12) (0)

There are no publications for FoxO1/FKHR Antibody (H00002308-M12).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxO1/FKHR Antibody (H00002308-M12) (0)

There are no reviews for FoxO1/FKHR Antibody (H00002308-M12). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FoxO1/FKHR Antibody (H00002308-M12) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxO1/FKHR Products

Bioinformatics Tool for FoxO1/FKHR Antibody (H00002308-M12)

Discover related pathways, diseases and genes to FoxO1/FKHR Antibody (H00002308-M12). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxO1/FKHR Antibody (H00002308-M12)

Discover more about diseases related to FoxO1/FKHR Antibody (H00002308-M12).
 

Pathways for FoxO1/FKHR Antibody (H00002308-M12)

View related products by pathway.

PTMs for FoxO1/FKHR Antibody (H00002308-M12)

Learn more about PTMs related to FoxO1/FKHR Antibody (H00002308-M12).
 

Research Areas for FoxO1/FKHR Antibody (H00002308-M12)

Find related products by research area.

Blogs on FoxO1/FKHR.

FOXO1/FKHR (fork head in Rhabdomyosarcoma)
FOXO1 belongs to the very large Forkhead family of transcription factors which contain a conserved distinct DNA-binding domain known as the Forkhead Box, or FOX. The Forkhead domain is a 100 amino acid long motif capable of binding and bending DNA,...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxO1/FKHR Antibody (3A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXO1
Entrez
OMIM
Uniprot