FoxN1 Antibody

Images

 
Immunohistochemistry-Paraffin: FoxN1 Antibody [NBP1-83886] - Staining of human stomach shows strong cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Product Discontinued
View other related FoxN1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-83886
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FoxN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SCSSFVSDGPPERTPSLPPHSPCIASPGPEQVQGHCPAGPGPGPFRLSPSDKYPGFGFEEAAASSPGRFLKGSHAPFHPYKR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FOXN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FoxN1 Antibody

  • FKHL20
  • forkhead box N1
  • forkhead box protein N1
  • FoxN1
  • RONU
  • Rowett nude
  • WHN
  • WHNRONU
  • winged helix nude
  • winged-helix nude
  • Winged-helix transcription factor nude

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7565
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-46246
Species: Hu
Applications: WB, IHC, IHC-P
MAB6519
Species: Hu, Mu
Applications: WB, IHC
MAB6184
Species: Mu
Applications: WB, CyTOF-ready, ICFlow
NBP1-83153
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-47428
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-86960
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
44880002
Species: Hu
Applications: WB, ELISA
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBL1-10820
Species: Hu
NBP2-45825
Species: Hu
Applications: WB, IHC
NBP1-85445
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP2-47453
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00139628-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF5708
Species: Hu
Applications: WB, ICC
NBP1-83886
Species: Hu
Applications: IHC, IHC-P

Publications for FoxN1 Antibody (NBP1-83886) (0)

There are no publications for FoxN1 Antibody (NBP1-83886).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxN1 Antibody (NBP1-83886) (0)

There are no reviews for FoxN1 Antibody (NBP1-83886). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FoxN1 Antibody (NBP1-83886) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxN1 Products

Bioinformatics Tool for FoxN1 Antibody (NBP1-83886)

Discover related pathways, diseases and genes to FoxN1 Antibody (NBP1-83886). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxN1 Antibody (NBP1-83886)

Discover more about diseases related to FoxN1 Antibody (NBP1-83886).
 

Pathways for FoxN1 Antibody (NBP1-83886)

View related products by pathway.

PTMs for FoxN1 Antibody (NBP1-83886)

Learn more about PTMs related to FoxN1 Antibody (NBP1-83886).

Blogs on FoxN1

There are no specific blogs for FoxN1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXN1
Entrez