FOXL1 Antibody (3C6)

Images

 

Product Details

Summary
Product Discontinued
View other related FOXL1 Primary Antibodies

Order Details


    • Catalog Number
      H00002300-M05
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FOXL1 Antibody (3C6) Summary

Immunogen
FOXL1 (NP_005241, 132 a.a. - 240 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPSPLLDGPSPPAPLHWPGTASPNEDAGDAAQGAAAVAVGQAARTGDGP
Specificity
FOXL1 (3C6)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FOXL1 Antibody (3C6)

  • FKH6forkhead box protein L1
  • FKHL11forkhead-like 11
  • forkhead box L1
  • Forkhead-related protein FKHL11
  • Forkhead-related transcription factor 7
  • FREAC7FREAC-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
AF4798
Species: Hu, Mu
Applications: WB
NB100-1271
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
AF1726
Species: Hu
Applications: WB, IHC, ICC
NBP1-82991
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1384
Species: Hu
Applications: WB, IHC, ICC
AF2400
Species: Hu
Applications: WB, ChIP, ICC
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
3900-WN/CF
Species: Mu
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-30961
Species: Hu
Applications: WB, ChIP, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00094234-M07
Species: Hu
Applications: ELISA, ICC/IF

Publications for FOXL1 Antibody (H00002300-M05) (0)

There are no publications for FOXL1 Antibody (H00002300-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FOXL1 Antibody (H00002300-M05) (0)

There are no reviews for FOXL1 Antibody (H00002300-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for FOXL1 Antibody (H00002300-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FOXL1 Products

Bioinformatics Tool for FOXL1 Antibody (H00002300-M05)

Discover related pathways, diseases and genes to FOXL1 Antibody (H00002300-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FOXL1 Antibody (H00002300-M05)

Discover more about diseases related to FOXL1 Antibody (H00002300-M05).
 

Pathways for FOXL1 Antibody (H00002300-M05)

View related products by pathway.

PTMs for FOXL1 Antibody (H00002300-M05)

Learn more about PTMs related to FOXL1 Antibody (H00002300-M05).

Blogs on FOXL1

There are no specific blogs for FOXL1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FOXL1 Antibody (3C6) and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXL1
Entrez
OMIM
Uniprot