FoxF2 Antibody (4F8)


ELISA: FoxF2 Antibody (4F8) [H00002295-M15] - Detection limit for recombinant GST tagged FOXF2 is approximately 3ng/ml as a capture antibody.

Product Details

Product Discontinued
View other related FoxF2 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FoxF2 Antibody (4F8) Summary

FOXF2 (NP_001443 207 a.a. - 340 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. YHRVVSGLGFGASLLPQGFDFQAPPSAPLGCHSQGGYGGLDMMPAGYDAGAGAPSHAHPHIECHSPYTSPAAHW
FOXF2 (4F8)
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxF2 Antibody (4F8)

  • FKHL6
  • FKHL6forkhead box protein F2
  • forkhead box F2
  • forkhead-like 6
  • Forkhead-related activator 2
  • Forkhead-related protein FKHL6
  • Forkhead-related transcription factor 2
  • FoxF2
  • FREAC2


FOXF2 encodes forkhead box F2, one of many human homologues of the Drosophila melanogaster transcription factor forkhead. FOXF2 is expressed in lung and placenta, and has been shown to transcriptionally activate several lung-specific genes.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Ze
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FoxF2 Antibody (H00002295-M15) (0)

There are no publications for FoxF2 Antibody (H00002295-M15).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxF2 Antibody (H00002295-M15) (0)

There are no reviews for FoxF2 Antibody (H00002295-M15). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxF2 Antibody (H00002295-M15) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FoxF2 Products

FoxF2 H00002295-M15

Bioinformatics Tool for FoxF2 Antibody (H00002295-M15)

Discover related pathways, diseases and genes to FoxF2 Antibody (H00002295-M15). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxF2 Antibody (H00002295-M15)

Discover more about diseases related to FoxF2 Antibody (H00002295-M15).

Pathways for FoxF2 Antibody (H00002295-M15)

View related products by pathway.

PTMs for FoxF2 Antibody (H00002295-M15)

Learn more about PTMs related to FoxF2 Antibody (H00002295-M15).

Blogs on FoxF2

There are no specific blogs for FoxF2, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FoxF2 Antibody (4F8) and receive a gift card or discount.


Gene Symbol FOXF2