FoxF2 Antibody (3D11) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related FoxF2 Primary Antibodies

Order Details


    • Catalog Number
      H00002295-M08G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FoxF2 Antibody (3D11) [DyLight 488] Summary

Immunogen
FOXF2 (NP_001443 346 a.a. - 443 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SPYLKQPPALTPSSNPAASAGLHSSMSSYSLEQSYLHQNAREDLSVGLPRYQHHSTPVCDRKDFVLNFNGISSFHPSASGSYYHHHHQSVCQDIKPCV
Specificity
FOXF2 - forkhead box F2
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FOXF2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxF2 Antibody (3D11) [DyLight 488]

  • FKHL6
  • FKHL6forkhead box protein F2
  • forkhead box F2
  • forkhead-like 6
  • Forkhead-related activator 2
  • Forkhead-related protein FKHL6
  • Forkhead-related transcription factor 2
  • FoxF2
  • FREAC2
  • FREAC2FREAC-2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4798
Species: Hu, Mu
Applications: WB
H00010210-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1268
Species: Hu, Ze
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-31376
Species: Hu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP2-16521
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-45269
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00094234-M07
Species: Hu
Applications: ELISA, ICC/IF
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
MAB4218
Species: Hu
Applications: WB, IHC
NBP2-34143
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60531
Species: Hu, Mu, Rt(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
NBP2-38866
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FoxF2 Antibody (H00002295-M08G) (0)

There are no publications for FoxF2 Antibody (H00002295-M08G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxF2 Antibody (H00002295-M08G) (0)

There are no reviews for FoxF2 Antibody (H00002295-M08G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FoxF2 Antibody (H00002295-M08G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxF2 Products

FoxF2 H00002295-M08G

Bioinformatics Tool for FoxF2 Antibody (H00002295-M08G)

Discover related pathways, diseases and genes to FoxF2 Antibody (H00002295-M08G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxF2 Antibody (H00002295-M08G)

Discover more about diseases related to FoxF2 Antibody (H00002295-M08G).
 

Pathways for FoxF2 Antibody (H00002295-M08G)

View related products by pathway.

PTMs for FoxF2 Antibody (H00002295-M08G)

Learn more about PTMs related to FoxF2 Antibody (H00002295-M08G).

Blogs on FoxF2

There are no specific blogs for FoxF2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxF2 Antibody (3D11) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXF2
Entrez