FoxC2 Antibody (2H3) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related FoxC2 Primary Antibodies

Order Details


    • Catalog Number
      H00002303-M02G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FoxC2 Antibody (2H3) [DyLight 488] Summary

Immunogen
FOXC2 (NP_005242, 421 a.a. ~ 501 a.a) partial recombinant protein with GST tag. AASWYLNHSGDLNHLPGHTFAAQQQTFPNVREMFNSHRLGIENSTLGESQVSGNASCQLPYRSTPPLYRHAAPYSYDCTKY
Specificity
FOXC2 (2H3)
Isotype
IgG2b Lambda
Clonality
Monoclonal
Host
Mouse
Gene
FOXC2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Protein A purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FoxC2 Antibody (2H3) [DyLight 488]

  • Fkh14
  • FKHL14LD
  • forkhead box C2 (MFH-1, mesenchyme forkhead 1)
  • forkhead, Drosophila, homolog-like 14
  • Forkhead-related protein FKHL14
  • FoxC2
  • LD
  • Mesenchyme fork head protein 1
  • mesenchyme forkhead 1
  • MFH-1 protein
  • MFH1
  • MFH-1
  • MFH1forkhead box protein C2
  • Transcription factor FKH-14

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00001646-M03
Species: Hu
Applications: WB, ELISA
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22449
Species: Hu, Mu, Rt, Fe, GP, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, GS
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-07799
Species: Hu
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB110-40877
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
H00002303-M02G
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for FoxC2 Antibody (H00002303-M02G) (0)

There are no publications for FoxC2 Antibody (H00002303-M02G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxC2 Antibody (H00002303-M02G) (0)

There are no reviews for FoxC2 Antibody (H00002303-M02G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FoxC2 Antibody (H00002303-M02G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FoxC2 Products

Bioinformatics Tool for FoxC2 Antibody (H00002303-M02G)

Discover related pathways, diseases and genes to FoxC2 Antibody (H00002303-M02G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxC2 Antibody (H00002303-M02G)

Discover more about diseases related to FoxC2 Antibody (H00002303-M02G).
 

Pathways for FoxC2 Antibody (H00002303-M02G)

View related products by pathway.

PTMs for FoxC2 Antibody (H00002303-M02G)

Learn more about PTMs related to FoxC2 Antibody (H00002303-M02G).

Blogs on FoxC2.

The affects of Perilipin 2 on diet and metabolism
Perilipin 2 belongs to the Perilipin family, which consists of proteins that coat intracellular lipid storage droplets. Perilipin 2 in particular is involved in lipid globule surface membrane composition, and has also been implicated in the develo...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FoxC2 Antibody (2H3) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol FOXC2
Entrez