FoxC1 Antibody


Western Blot: FOXC1 Antibody [NBP1-69224] - Titration: 0.2-1 ug/ml, Positive Control: Jurkat cell lysate.

Product Details

Product Discontinued
View other related FoxC1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FoxC1 Antibody Summary

Synthetic peptides corresponding to FOXC1 (forkhead box C1) The peptide sequence was selected from the C terminal of FOXC1. Peptide sequence QQNFHSVREMFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDC.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FOXC1 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FoxC1 Antibody

  • ARA
  • FKHL7
  • forkhead box C1
  • forkhead box protein C1
  • forkhead, drosophila, homolog-like 7
  • forkhead/winged helix-like transcription factor 7
  • forkhead-related activator 3
  • Forkhead-related protein FKHL7
  • Forkhead-related transcription factor 3
  • FoxC1
  • FREAC3
  • FREAC-3
  • IGDA
  • IHG1
  • IRID1
  • myeloid factor-delta
  • RIEG3


FOXC1 belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The specific function of this gene has not yet been determined; however, it has been shown to play a role in the regulation of embryonic and ocular development. Mutations in this gene cause various glaucoma phenotypes including primary congenital glaucoma, autosomal dominant iridogoniodysgenesis anomaly, and Axenfeld-Rieger anomaly.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP, ICC
Species: Hu
Applications: WB, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB

Publications for FoxC1 Antibody (NBP1-69224) (0)

There are no publications for FoxC1 Antibody (NBP1-69224).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FoxC1 Antibody (NBP1-69224) (0)

There are no reviews for FoxC1 Antibody (NBP1-69224). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FoxC1 Antibody (NBP1-69224) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FoxC1 Products

Bioinformatics Tool for FoxC1 Antibody (NBP1-69224)

Discover related pathways, diseases and genes to FoxC1 Antibody (NBP1-69224). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FoxC1 Antibody (NBP1-69224)

Discover more about diseases related to FoxC1 Antibody (NBP1-69224).

Pathways for FoxC1 Antibody (NBP1-69224)

View related products by pathway.

PTMs for FoxC1 Antibody (NBP1-69224)

Learn more about PTMs related to FoxC1 Antibody (NBP1-69224).

Research Areas for FoxC1 Antibody (NBP1-69224)

Find related products by research area.

Blogs on FoxC1

There are no specific blogs for FoxC1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FoxC1 Antibody and receive a gift card or discount.


Gene Symbol FOXC1