FNTA Antibody

Images

 
Western Blot: FNTA Antibody [H00002339-B02P] - Analysis of FNTA expression in transfected 293T cell line by FNTA polyclonal antibody. Lane 1: FNTA transfected lysate(26.00 KDa). Lane 2: Non-transfected lysate.
Immunocytochemistry/ Immunofluorescence: FNTA Antibody [H00002339-B02P] - Analysis of purified antibody to FNTA on HeLa cell. (antibody concentration 20 ug/ml)

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FNTA Antibody Summary

Immunogen
FNTA (AAH37295.1, 1 a.a. - 214 a.a.) full-length human protein. MSCTVRDVYDYFRAVLQRDERSERAFKLTRDAIELNAANYTVWHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADILNQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVISNTTGYNDRAVLEREVQLVISFTCSFVTNMFACLPYLRHWGYSRSRSYPMELKEDRVLSGT
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FNTA
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FNTA Antibody

  • CAAX farnesyltransferase subunit alpha
  • EC 2.5.1.58
  • EC 2.5.1.59
  • farnesyl-protein transferase alpha-subunit
  • farnesyltransferase, CAAX box, alpha
  • FPTA
  • FTase-alpha
  • GGTase-I-alpha
  • MGC99680
  • PGGT1A
  • protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
  • protein prenyltransferase alpha subunit repeat containing 2
  • PTAR2
  • Ras proteins prenyltransferase subunit alpha
  • type I protein geranyl-geranyltransferase alpha subunit
  • Type I protein geranyl-geranyltransferase subunit alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-38002
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF6898
Species: Hu, Mu, Rt
Applications: WB
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-91795
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2387
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31029
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
AF-241-NA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
AF3025
Species: Hu
Applications: WB, ICC
NB400-144
Species: Hu, Mu, Rt, Po, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-94887
Species: Hu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
AF4036
Species: Hu
Applications: WB, Simple Western
NBP2-45745
Species: Hu
Applications: WB, IHC, IF
NB300-155
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
H00002339-B02P
Species: Hu
Applications: WB, ICC/IF

Publications for FNTA Antibody (H00002339-B02P) (0)

There are no publications for FNTA Antibody (H00002339-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FNTA Antibody (H00002339-B02P) (0)

There are no reviews for FNTA Antibody (H00002339-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FNTA Antibody (H00002339-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FNTA Products

Bioinformatics Tool for FNTA Antibody (H00002339-B02P)

Discover related pathways, diseases and genes to FNTA Antibody (H00002339-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FNTA Antibody (H00002339-B02P)

Discover more about diseases related to FNTA Antibody (H00002339-B02P).
 

Pathways for FNTA Antibody (H00002339-B02P)

View related products by pathway.

PTMs for FNTA Antibody (H00002339-B02P)

Learn more about PTMs related to FNTA Antibody (H00002339-B02P).
 

Research Areas for FNTA Antibody (H00002339-B02P)

Find related products by research area.

Blogs on FNTA

There are no specific blogs for FNTA, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FNTA Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FNTA