FMRP Antibody (3E11.) [Biotin]

Images

 
ELISA: FMRP Antibody (3E11) [Biotin] [H00002332-M03B] - Detection limit for recombinant GST tagged FMR1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related FMRP Primary Antibodies

Order Details


    • Catalog Number
      H00002332-M03B
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FMRP Antibody (3E11.) [Biotin] Summary

Immunogen
FMR1 (NP_002015, 121 a.a. - 220 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ATKDTFHKIKLDVPEDLRQMCAKEAAHKDFKKAVGAFSVTYDPENYQLVILSINEVTSKRAHMLIDMHFRSLRTKLSLIMRNEEASKQLESSRQLASRFH
Specificity
FMR1 - fragile X mental retardation 1 (3E11)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FMR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
Positive Control
FMRP Lysate (NBP2-65715)

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FMRP Antibody (3E11.) [Biotin]

  • FMRPFRAXAPOF
  • fragile X mental retardation 1 protein
  • fragile X mental retardation 1
  • MGC87458
  • POF1
  • premature ovarian failure 1
  • Protein FMR-1

Background

The protein encoded by this gene binds RNA and is associated with polysomes. The encoded protein may be involved in mRNA trafficking from the nucleus to the cytoplasm. A trinucleotide repeat (CGG) in the 5' UTR is normally found at 6-53 copies, but an expansion to 55-230 repeats is the cause of fragile X syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-55795
Species: Hu
Applications: ICC/IF
NBP1-81872
Species: Hu
Applications: IHC, IHC-P
NBP1-89546
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB300-259
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4514
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-84310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-42827
Species: Hu, Mu, Rt, Ch, Fi, Re, Xp
Applications: WB, ICC/IF, IHC, IHC-Fr
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-1277
Species: Hu, Mu, Ft
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IF, IHC-WhMt
NB100-56326
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-04611
Species: Hu
NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
PP-A9033A-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NBP2-19586
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-88191
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13195
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FMRP Antibody (H00002332-M03B) (0)

There are no publications for FMRP Antibody (H00002332-M03B).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FMRP Antibody (H00002332-M03B) (0)

There are no reviews for FMRP Antibody (H00002332-M03B). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FMRP Antibody (H00002332-M03B) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for FMRP Antibody (H00002332-M03B)

Discover related pathways, diseases and genes to FMRP Antibody (H00002332-M03B). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FMRP Antibody (H00002332-M03B)

Discover more about diseases related to FMRP Antibody (H00002332-M03B).
 

Pathways for FMRP Antibody (H00002332-M03B)

View related products by pathway.

PTMs for FMRP Antibody (H00002332-M03B)

Learn more about PTMs related to FMRP Antibody (H00002332-M03B).
 

Research Areas for FMRP Antibody (H00002332-M03B)

Find related products by research area.

Blogs on FMRP

There are no specific blogs for FMRP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FMRP Antibody (3E11.) [Biotin] and receive a gift card or discount.

Bioinformatics

Gene Symbol FMR1
Entrez
Uniprot