Recombinant Human Flt-3 Ligand Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Flt-3 Ligand Protein Summary

Description
Flt-3 Ligand (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSE
Protein/Peptide Type
Partial Recombinant Protein
Gene
FLT3LG

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Flt-3 Ligand Protein

  • FL
  • Flt3 ligand
  • Flt-3 Ligand
  • Flt3L
  • FLT3LG
  • fms-related tyrosine kinase 3 ligand
  • SL cytokine

Background

FLT3LG - fms-related tyrosine kinase 3 ligand

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-1071
Species: Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
NBP1-84550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00002323-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01) (0)

There are no publications for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01) (0)

There are no reviews for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Recombinant Human Flt-3 Ligand Protein Products

Related Products by Gene

Bioinformatics Tool for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01)

Discover related pathways, diseases and genes to Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01)

Discover more about diseases related to Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01).
 

Pathways for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01)

View related products by pathway.

PTMs for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01)

Learn more about PTMs related to Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01).
 

Research Areas for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01)

Find related products by research area.

Blogs on Flt-3 Ligand

There are no specific blogs for Flt-3 Ligand, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Flt-3 Ligand Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FLT3LG
Entrez
Uniprot

Customers Who Bought This Also Bought