Recombinant Human Flt-3 Ligand Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Flt-3 Ligand Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human FLT3LG partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
FLT3LG
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Flt-3 Ligand Protein

  • FL
  • Flt3 ligand
  • Flt-3 Ligand
  • Flt3L
  • FLT3LG
  • fms-related tyrosine kinase 3 ligand
  • SL cytokine

Background

FLT3LG - fms-related tyrosine kinase 3 ligand

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42210
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-50811
Species: Hu
Applications: WB, ELISA, IA, S-ELISA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc

Publications for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01) (0)

There are no publications for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01) (0)

There are no reviews for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Flt-3 Ligand Products

Bioinformatics Tool for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01)

Discover related pathways, diseases and genes to Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01)

Discover more about diseases related to Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01).
 

Pathways for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01)

View related products by pathway.

PTMs for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01)

Learn more about PTMs related to Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01).
 

Research Areas for Flt-3 Ligand Partial Recombinant Protein (H00002323-Q01)

Find related products by research area.

Blogs on Flt-3 Ligand

There are no specific blogs for Flt-3 Ligand, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-4 [Unconjugated]
204-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Flt-3 Ligand Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FLT3LG
Entrez