Flt-3 Ligand Antibody


Western Blot: Flt-3 Ligand Antibody [NBP1-69332] - This Anti- Flt-3 Ligand antibody was used in Western Blot of Fetal Muscle tissue lysate at a concentration of 1ug/ml.

Product Details

Product Discontinued
View other related Flt-3 Ligand Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Flt-3 Ligand Antibody Summary

Synthetic peptides corresponding to FLT3LG(fms-related tyrosine kinase 3 ligand) The peptide sequence was selected from the N terminal of FLT3LG. Peptide sequence TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FLT3LG and was validated on Western blot.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Flt-3 Ligand Antibody

  • FL
  • Flt3 ligand
  • Flt-3 Ligand
  • Flt3L
  • FLT3LG
  • fms-related tyrosine kinase 3 ligand
  • SL cytokine


FLT3LG stimulates the proliferation of early hematopoietic cells and synergizes well with a number of other colony stimulating factors and interleukins.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc

Publications for Flt-3 Ligand Antibody (NBP1-69332) (0)

There are no publications for Flt-3 Ligand Antibody (NBP1-69332).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flt-3 Ligand Antibody (NBP1-69332) (0)

There are no reviews for Flt-3 Ligand Antibody (NBP1-69332). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flt-3 Ligand Antibody (NBP1-69332) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Flt-3 Ligand Products

Bioinformatics Tool for Flt-3 Ligand Antibody (NBP1-69332)

Discover related pathways, diseases and genes to Flt-3 Ligand Antibody (NBP1-69332). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flt-3 Ligand Antibody (NBP1-69332)

Discover more about diseases related to Flt-3 Ligand Antibody (NBP1-69332).

Pathways for Flt-3 Ligand Antibody (NBP1-69332)

View related products by pathway.

PTMs for Flt-3 Ligand Antibody (NBP1-69332)

Learn more about PTMs related to Flt-3 Ligand Antibody (NBP1-69332).

Research Areas for Flt-3 Ligand Antibody (NBP1-69332)

Find related products by research area.

Blogs on Flt-3 Ligand

There are no specific blogs for Flt-3 Ligand, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Flt-3 Ligand Antibody and receive a gift card or discount.


Gene Symbol FLT3LG