Recombinant Human Flt-3/Flk-2/CD135 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Flt-3/Flk-2/CD135 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 91-190 of Human Flt-3/Flk-2/CD135

Source: Wheat Germ

Amino Acid Sequence: LQVLVDAPGNISCLWVFKHSSLNCQPHFDLQNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQDALVCISESVP

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
FLT3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Flt-3/Flk-2/CD135 Protein

  • CD135 antigen
  • CD135
  • EC 2.7.10
  • fetal liver kinase 2
  • FL cytokine receptor
  • FLK2
  • Flk-2
  • FLT3 receptor tyrosine kinase
  • Flt3
  • Flt-3
  • Fms-like tyrosine kinase 3
  • fms-related tyrosine kinase 3
  • growth factor receptor tyrosine kinase type III
  • Stem cell tyrosine kinase 1
  • STK-1
  • STK1EC 2.7.10.1
  • Tyrosine-protein kinase receptor FLT3

Background

FLT3 - fms-related tyrosine kinase 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2168
Species: Hu, Mu
Applications: WB, Simple Western, ChIP
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow, KO
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB600-248
Species: Hu
Applications: WB, IP
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP1-26612
Species: Hu
Applications: IP (-), WB
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-37289
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow

Publications for Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01) (0)

There are no publications for Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01) (0)

There are no reviews for Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Flt-3/Flk-2/CD135 Products

Bioinformatics Tool for Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01)

Discover related pathways, diseases and genes to Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01)

Discover more about diseases related to Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01).
 

Pathways for Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01)

View related products by pathway.

PTMs for Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01)

Learn more about PTMs related to Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01).
 

Research Areas for Flt-3/Flk-2/CD135 Partial Recombinant Protein (H00002322-Q01)

Find related products by research area.

Blogs on Flt-3/Flk-2/CD135

There are no specific blogs for Flt-3/Flk-2/CD135, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-3 [Unconjugated]
203-IL-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Flt-3/Flk-2/CD135 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FLT3
Entrez