FLJ23356 Antibody (6F10) [DyLight 488]

Images

 

Product Details

Summary
Product Discontinued
View other related FLJ23356 Primary Antibodies

Order Details


    • Catalog Number
      H00084197-M03G
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FLJ23356 Antibody (6F10) [DyLight 488] Summary

Immunogen
FLJ23356 (NP_115613, 251 a.a. ~ 351 a.a) partial recombinant protein with GST tag.GDFVAPEQLWPYGEDVPFHDDLMPSYDEKIDIWKIPDISSFL LGHIEGSDMVRFHLFDIHKACKSQTPSERPTAQDVLETYQKV LDTLRDAMMSQAREML
Specificity
FLJ23356 - hypothetical protein FLJ23356
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SGK196
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FLJ23356 Antibody (6F10) [DyLight 488]

  • FLJ23356
  • MGC126597
  • protein kinase-like protein SgK196
  • Sugen kinase 196

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for FLJ23356 Antibody (H00084197-M03G) (0)

There are no publications for FLJ23356 Antibody (H00084197-M03G).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ23356 Antibody (H00084197-M03G) (0)

There are no reviews for FLJ23356 Antibody (H00084197-M03G). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FLJ23356 Antibody (H00084197-M03G) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FLJ23356 Products

Bioinformatics Tool for FLJ23356 Antibody (H00084197-M03G)

Discover related pathways, diseases and genes to FLJ23356 Antibody (H00084197-M03G). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for FLJ23356 Antibody (H00084197-M03G)

Find related products by research area.

Blogs on FLJ23356

There are no specific blogs for FLJ23356, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FLJ23356 Antibody (6F10) [DyLight 488] and receive a gift card or discount.

Bioinformatics

Gene Symbol SGK196