FLJ10808 Antibody


Western Blot: FLJ10808 Antibody [NBP1-69106] - Titration: 0.2-1 ug/ml, Positive Control: HT1080 cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

FLJ10808 Antibody Summary

Synthetic peptides corresponding to UBA6 (ubiquitin-like modifier activating enzyme 6) The peptide sequence was selected from the middle region of UBA6. Peptide sequence EVIVPHLTESYNSHRDPPEEEIPFCTLKSFPAAIEHTIQWARDKFESSFS.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against UBA6 and was validated on Western blot.
Theoretical MW
118 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FLJ10808 Antibody

  • E1-L2
  • FLJ10808
  • FLJ23367
  • Monocyte protein 4
  • MOP4
  • MOP-4
  • UBA6, ubiquitin-activating enzyme E1
  • UBE1L2
  • Ubiquitin-activating enzyme 6
  • ubiquitin-activating enzyme E1-like 2
  • Ubiquitin-activating enzyme E1-like protein 2
  • ubiquitin-like modifier activating enzyme 6
  • ubiquitin-like modifier-activating enzyme 6


Modification of proteins with ubiquitin (UBB; MIM 191339) or ubiquitin-like proteins controls many signaling networks and requires a ubiquitin-activating enzyme (E1), a ubiquitin conjugating enzyme (E2), and a ubiquitin protein ligase (E3). UBE1L2 is an E1 enzyme that initiates the activation and conjugation of ubiquitin-like proteins (Jin et al., 2007 [PubMed 17597759]).


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
Species: Hu
Applications: WB, IP, PLA
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, KO
Species: Hu, Mu
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Applications: WB

Publications for FLJ10808 Antibody (NBP1-69106) (0)

There are no publications for FLJ10808 Antibody (NBP1-69106).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLJ10808 Antibody (NBP1-69106) (0)

There are no reviews for FLJ10808 Antibody (NBP1-69106). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FLJ10808 Antibody (NBP1-69106) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FLJ10808 Products

Bioinformatics Tool for FLJ10808 Antibody (NBP1-69106)

Discover related pathways, diseases and genes to FLJ10808 Antibody (NBP1-69106). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLJ10808 Antibody (NBP1-69106)

Discover more about diseases related to FLJ10808 Antibody (NBP1-69106).

Pathways for FLJ10808 Antibody (NBP1-69106)

View related products by pathway.

PTMs for FLJ10808 Antibody (NBP1-69106)

Learn more about PTMs related to FLJ10808 Antibody (NBP1-69106).

Blogs on FLJ10808

There are no specific blogs for FLJ10808, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FLJ10808 Antibody and receive a gift card or discount.


Gene Symbol UBA6