FLAD1 Antibody


Western Blot: FLAD1 Antibody [NBP1-53059] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related FLAD1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FLAD1 Antibody Summary

Synthetic peptide corresponding to a region of FLAD1 (FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae)). The peptide sequence was selected from the N terminal of FLAD1, within the amino acid range: PGRSVTAGIIIVGDEILKGHTQDTNTFFLCRTLRSLGVQVCRVSVVP.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FLAD1 and was validated on Western blot.
FLAD1 Lysate (NBP2-65970)

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FLAD1 Antibody

  • EC 2.7.7
  • FAD1 flavin adenine dinucleotide synthetase homolog (S. cerevisiae)
  • FAD1
  • Fad1, flavin adenine dinucleotide synthetase, homolog (yeast)
  • FAD-synthetase
  • Flavin adenine dinucleotide synthase
  • flavin adenine dinucleotide synthetase
  • flavin adenine dinucleotide synthetase, homolog
  • MGC31803
  • MGC40255
  • PP591


FLAD1 catalyzes the adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme.This gene encodes the enzyme that catalyzes adenylation of flavin mononucleotide (FMN) to form flavin adenine dinucleotide (FAD) coenzyme. Alternatively spliced transcript variants encoding distinct isoforms have been observed.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Ye
Applications: WB
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Bv, Ch, Fe, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Av
Applications: WB, EIA, Flow, IHC, IHC-Fr, IHC-P, IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for FLAD1 Antibody (NBP1-53059) (0)

There are no publications for FLAD1 Antibody (NBP1-53059).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FLAD1 Antibody (NBP1-53059) (0)

There are no reviews for FLAD1 Antibody (NBP1-53059). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FLAD1 Antibody (NBP1-53059) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for FLAD1 Antibody (NBP1-53059)

Discover related pathways, diseases and genes to FLAD1 Antibody (NBP1-53059). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FLAD1 Antibody (NBP1-53059)

Discover more about diseases related to FLAD1 Antibody (NBP1-53059).

Pathways for FLAD1 Antibody (NBP1-53059)

View related products by pathway.

PTMs for FLAD1 Antibody (NBP1-53059)

Learn more about PTMs related to FLAD1 Antibody (NBP1-53059).

Blogs on FLAD1

There are no specific blogs for FLAD1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FLAD1 Antibody and receive a gift card or discount.


Gene Symbol FLAD1