Recombinant Human FKBP52/FKBP4 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related FKBP52/FKBP4 Peptides and Proteins

Order Details


    • Catalog Number
      H00002288-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human FKBP52/FKBP4 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human FKBP4 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EYESSFSNEEAQKAQALRLASHLNLAMCHLKLQAFSAAIESCNKALELDSNNEKGLFRRGEAHLAVNDFELARADFQKVLQLYPNNKAAKTQLAVCQQRIRRQLAREKKL

Protein/Peptide Type
Partial Recombinant Protein
Gene
FKBP4

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FKBP52/FKBP4 Protein

  • 51 kDa FK506-binding protein
  • 52 kDa FKBP
  • 59 kDa immunophilin
  • EC 5.2.1.8
  • FK506 binding protein 4, 59kDa
  • FK506-binding protein 4 (59kD)
  • FK506-binding protein 4
  • FKBP4
  • FKBP-4
  • FKBP51
  • FKBP52
  • FKBP-52
  • FKBP52T-cell FK506-binding protein, 59kD
  • FKBP59
  • FKBP5952 kDa FK506-binding protein
  • HBI
  • HSP binding immunophilin
  • Hsp56
  • HSP-binding immunophilin
  • Immunophilin FKBP52
  • p52
  • p59
  • peptidyl-prolyl cis-trans isomerase FKBP4
  • peptidylprolyl cis-trans isomerase
  • PPIase FKBP4
  • PPIase
  • rotamase

Background

FKBP4 - FK506 binding protein 4, 59kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88650
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01345
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2699
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-02665
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13883
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74648
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-85841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-179
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, Flow, ICC/IF, IP
NBP1-88815
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01) (0)

There are no publications for FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01) (0)

There are no reviews for FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FKBP52/FKBP4 Products

Bioinformatics Tool for FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01)

Discover related pathways, diseases and genes to FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01)

Discover more about diseases related to FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01).
 

Pathways for FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01)

View related products by pathway.

PTMs for FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01)

Learn more about PTMs related to FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01).
 

Research Areas for FKBP4/FKBP52 Partial Recombinant Protein (H00002288-Q01)

Find related products by research area.

Blogs on FKBP52/FKBP4

There are no specific blogs for FKBP52/FKBP4, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FKBP52/FKBP4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP4
Entrez