Recombinant Human FKBP12 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human FKBP12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-108 of Human FKBP1A full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFMLGKQEVIRGWEEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPHATLVFDVELLKLE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Predicted Species
Mouse (100%). Backed by our 100% Guarantee.
Protein/Peptide Type
Recombinant Protein
Gene
FKBP1A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.62 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using H00002280-P01.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FKBP12 Protein

  • 12 kDa FKBP
  • EC 5.2.1.8
  • FK506 binding protein 1A, 12kDa
  • FK506-binding protein 1A
  • FKBP1
  • FKBP12
  • FKBP12C
  • FKBP12FKBP12-Exip3
  • FKBP-12T-cell, 12-kD
  • FKBP1a
  • FKBP-1A
  • peptidyl-prolyl cis-trans isomerase FKBP1A
  • PKC12
  • PPIase FKBP1A
  • PPIASE
  • protein kinase C inhibitor 2
  • rotamase

Background

FKBP1A( AAH05147, 1 a.a. - 109 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-607
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
H00005478-M01
Species: Hu
Applications: WB, ELISA
NBP2-57062
Species: Hu
Applications: WB, ICC/IF
H00002288-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P, IP
H00005478-M01
Species: Hu
Applications: WB, ELISA
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, IHC, IHC-Fr, IHC-P, IP, B/N, IF
MAB7670
Species: Hu
Applications: WB, ICC
MAB2294
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-38604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90091
Species: Hu
Applications: IHC, IHC-P
NBP2-24503
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
AF4094
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, KO
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB120-2928
Species: Hu, Mu, Rt, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00002280-P01
Species: Hu, Mu
Applications: WB, ELISA, PA, AP

Publications for FKBP12 Recombinant Protein (H00002280-P01)(3)

Reviews for FKBP12 Recombinant Protein (H00002280-P01) (0)

There are no reviews for FKBP12 Recombinant Protein (H00002280-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FKBP12 Recombinant Protein (H00002280-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for FKBP12 Recombinant Protein (H00002280-P01)

Discover related pathways, diseases and genes to FKBP12 Recombinant Protein (H00002280-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FKBP12 Recombinant Protein (H00002280-P01)

Discover more about diseases related to FKBP12 Recombinant Protein (H00002280-P01).
 

Pathways for FKBP12 Recombinant Protein (H00002280-P01)

View related products by pathway.

Research Areas for FKBP12 Recombinant Protein (H00002280-P01)

Find related products by research area.

Blogs on FKBP12

There are no specific blogs for FKBP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FKBP12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FKBP1A
Entrez