Fibronectin Antibody

Images

 
Western Blot: Fibronectin/Anastellin Antibody [NBP1-53122] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: Fibronectin/Anastellin Antibody [NBP1-53122] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Jurkat cell lysate

Product Details

Summary
Product Discontinued
View other related Fibronectin Primary Antibodies

Order Details


    • Catalog Number
      NBP1-53122
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Fibronectin Antibody Summary

Immunogen
Synthetic peptides corresponding to FN1(fibronectin 1) The peptide sequence was selected from the C terminal of FN1. Peptide sequence NCRRPGGEPSPEGTTGQSYNQYSQRYHQRTNTNVNCPIECFMPLDVQADR.
Marker
Mesenchymal Cells Marker
Clonality
Polyclonal
Host
Rabbit
Gene
FN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FN1 and was validated on Western Blot

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Fibronectin Antibody

  • Fibronectin
  • FN1

Background

FN1 is a glycoprotein present in a soluble dimeric form in plasma, and in a dimeric or multimeric form at the cell surface and in extracellular matrix. Fibronectin is involved in cell adhesion and migration processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20866
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-53122
Species: Hu
Applications: WB

Publications for Fibronectin/Anastellin Antibody (NBP1-53122) (0)

There are no publications for Fibronectin/Anastellin Antibody (NBP1-53122).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibronectin/Anastellin Antibody (NBP1-53122) (0)

There are no reviews for Fibronectin/Anastellin Antibody (NBP1-53122). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibronectin/Anastellin Antibody (NBP1-53122) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibronectin Products

Bioinformatics Tool for Fibronectin/Anastellin Antibody (NBP1-53122)

Discover related pathways, diseases and genes to Fibronectin/Anastellin Antibody (NBP1-53122). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibronectin/Anastellin Antibody (NBP1-53122)

Discover more about diseases related to Fibronectin/Anastellin Antibody (NBP1-53122).
 

Pathways for Fibronectin/Anastellin Antibody (NBP1-53122)

View related products by pathway.

PTMs for Fibronectin/Anastellin Antibody (NBP1-53122)

Learn more about PTMs related to Fibronectin/Anastellin Antibody (NBP1-53122).
 

Research Areas for Fibronectin/Anastellin Antibody (NBP1-53122)

Find related products by research area.

Blogs on Fibronectin.

Alpha-smooth muscle actin and the modulation of endothelial and epithelial cell biology
Actin is essential for a wide range of cell functions, ranging from cell division and chromatin remodeling to vesicle trafficking and maintenance of cellular structure. In fact, mislocalization of actin to cell junctions during development leads t...  Read full blog post.

Epithelial-Mesenchymal Transition (EMT) Markers
Epithelial-Mesenchymal Transition (EMT) is the trans-differentiation of stationary epithelial cells into motile mesenchymal cells. During EMT, epithelial cells lose their junctions and apical-basal polarity, reorganize their cytoskeleton, undergo a...  Read full blog post.

Fibronectin: Organizing Cell Activity across the ECM
Fibronectin is a glycoprotein found in the extracellular matrix (ECM) that binds to integrins and other components of the ECM such as collagen and fibrin. Under normal physiological conditions, fibronectin is an important factor in cell adhesion, grow...  Read full blog post.

Using the Laminin Antibody in Angiogenesis Research
Laminin is one of a large number of proteins expressed on the basal laminar of the ECM (extracellular matrix). The laminin antibody database covers several proteins, which interact with integrins and other receptor proteins to support cellular differe...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibronectin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FN1
Entrez