Fibronectin/Anastellin Antibody (CL3730)

Images

 
Western Blot: Fibronectin/Anastellin Antibody (CL3730) [NBP2-61633] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10 Lane 2: Human cell line U-87 MG
Immunohistochemistry-Paraffin: Fibronectin/Anastellin Antibody (CL3730) [NBP2-61633] - Staining of human pancreas shows absence of immunoreactivity in glandular cells (negative control).
Immunohistochemistry-Paraffin: Fibronectin/Anastellin Antibody (CL3730) [NBP2-61633] - Staining of human endometrium shows strong immunoreactivity in endometrial stroma and basement membrane of glandular cells.
Immunohistochemistry-Paraffin: Fibronectin/Anastellin Antibody (CL3730) [NBP2-61633] - Staining of human placenta shows strong immunoreactivity in chorionic villi.
Immunohistochemistry-Paraffin: Fibronectin/Anastellin Antibody (CL3730) [NBP2-61633] - Staining of human testis shows immunoreactivity in the connective tissue surrounding seminiferous tubules.
Immunohistochemistry-Paraffin: Fibronectin/Anastellin Antibody (CL3730) [NBP2-61633] - Staining of human prostate shows moderate positivity in smooth muscle.
Immunohistochemistry-Paraffin: Fibronectin/Anastellin Antibody (CL3730) [NBP2-61633] - Staining of human small intestine shows strong immunoreactivity in the connective tissue.
Immunohistochemistry-Paraffin: Fibronectin/Anastellin Antibody (CL3730) [NBP2-61633] - Staining of human breast cancer shows strong immunoreactivity in tumor stroma.
Immunohistochemistry-Paraffin: Fibronectin/Anastellin Antibody (CL3730) [NBP2-61633] - Staining of human liver cancer shows strong positivity in tumor.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clone
CL3730
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fibronectin/Anastellin Antibody (CL3730) Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: HEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLRDQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSETGTFYQIGDSWEKYVHGVRYQCYCYGRGIG
Epitope
GRWKCDPVDQ
Specificity
Specificity of human Fibronectin/Anastellin antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (95%). Backed by our 100% Guarantee.
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
FN1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Control Peptide
Fibronectin/Anastellin Recombinant Protein Antigen (NBP2-61633PEP)

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Mouse-On-Mouse blocking reagent may be needed for IHC and ICC experiments to reduce high background signal. You can find these reagents under catalog numbers PK-2200-NB and MP-2400-NB. Please contact Technical Support if you have any questions

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for Fibronectin/Anastellin Antibody (CL3730)

  • CIGDKFZp686O13149
  • Cold-insoluble globulin
  • DKFZp686F10164
  • DKFZp686H0342
  • DKFZp686I1370
  • fibronectin 1
  • fibronectin
  • Fibronectin/Anastellin
  • FNFINC
  • FNZ
  • GFND2ED-B
  • LETSGFND
  • migration-stimulating factor
  • MSF

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67511
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-36561
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, B/N
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NB200-193
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for Fibronectin/Anastellin Antibody (NBP2-61633) (0)

There are no publications for Fibronectin/Anastellin Antibody (NBP2-61633).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibronectin/Anastellin Antibody (NBP2-61633) (0)

There are no reviews for Fibronectin/Anastellin Antibody (NBP2-61633). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibronectin/Anastellin Antibody (NBP2-61633). (Showing 1 - 1 of 1 FAQ).

  1. One of our clients is looking for antibodies against tenascin C and fibronectin that could be used for FFPE rat tissues. These antibodies should exclusively recognize tenascin C and fibronectin and do not cross react with each other. Can you inform me if you have these antibodies?
    • Here is a link to Tenascin C antibodies we have validated in rat tissues for IHC-P Here are antibodies we have validated in fibronectin in rat tissues for IHC-P

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Fibronectin/Anastellin Antibody (NBP2-61633)

Discover related pathways, diseases and genes to Fibronectin/Anastellin Antibody (NBP2-61633). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibronectin/Anastellin Antibody (NBP2-61633)

Discover more about diseases related to Fibronectin/Anastellin Antibody (NBP2-61633).
 

Pathways for Fibronectin/Anastellin Antibody (NBP2-61633)

View related products by pathway.

PTMs for Fibronectin/Anastellin Antibody (NBP2-61633)

Learn more about PTMs related to Fibronectin/Anastellin Antibody (NBP2-61633).

Blogs on Fibronectin/Anastellin

There are no specific blogs for Fibronectin/Anastellin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibronectin/Anastellin Antibody (CL3730) and receive a gift card or discount.

Bioinformatics

Gene Symbol FN1