Fibroblast Growth Factor Binding Protein 3 Antibody

Images

 
Immunohistochemistry: Fibroblast Growth Factor Binding Protein 3 Antibody [NBP2-30824] - Staining of human colon shows strong cytoplasmic positivity in goblet cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Fibroblast Growth Factor Binding Protein 3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AASNVAEPVPGPTGGSSGRFLSPEQHACSWQL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGFBP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Fibroblast Growth Factor Binding Protein 3 Protein (NBP2-30824PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Fibroblast Growth Factor Binding Protein 3 Antibody

  • C10orf13
  • Chromosome 10 Open Reading Frame 13
  • FGF-Binding Protein 3
  • FGFBP3
  • FGF-BP3
  • FGFBP-3
  • Fibroblast Growth Factor-Binding Protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1593
Species: Hu
Applications: WB
NB100-314
Species: Hu
Applications: WB, IP, PLA
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
MAB6302
Species: Hu
Applications: Flow, CyTOF-ready
AF4208
Species: Rt
Applications: WB
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-81341
Species: Hu
Applications: WB, IHC, IHC-P
H00001663-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
232-FA/CF
Species: Hu
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-481
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-30824
Species: Hu
Applications: IHC, IHC-P

Publications for Fibroblast Growth Factor Binding Protein 3 Antibody (NBP2-30824) (0)

There are no publications for Fibroblast Growth Factor Binding Protein 3 Antibody (NBP2-30824).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibroblast Growth Factor Binding Protein 3 Antibody (NBP2-30824) (0)

There are no reviews for Fibroblast Growth Factor Binding Protein 3 Antibody (NBP2-30824). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Fibroblast Growth Factor Binding Protein 3 Antibody (NBP2-30824) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibroblast Growth Factor Binding Protein 3 Products

Bioinformatics Tool for Fibroblast Growth Factor Binding Protein 3 Antibody (NBP2-30824)

Discover related pathways, diseases and genes to Fibroblast Growth Factor Binding Protein 3 Antibody (NBP2-30824). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibroblast Growth Factor Binding Protein 3 Antibody (NBP2-30824)

Discover more about diseases related to Fibroblast Growth Factor Binding Protein 3 Antibody (NBP2-30824).
 

Pathways for Fibroblast Growth Factor Binding Protein 3 Antibody (NBP2-30824)

View related products by pathway.

Blogs on Fibroblast Growth Factor Binding Protein 3

There are no specific blogs for Fibroblast Growth Factor Binding Protein 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibroblast Growth Factor Binding Protein 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGFBP3
Uniprot