Fibrinogen gamma chain Antibody

Images

 
Western Blot: fibrinogen gamma chain Antibody [NBP1-69287] - This Anti-FGG antibody was used in Western Blot of Fetal Liver tissue lysate at a concentration of 2.5ug/ml.

Product Details

Summary
Product Discontinued
View other related Fibrinogen gamma chain Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69287
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Fibrinogen gamma chain Antibody Summary

Immunogen
Synthetic peptides corresponding to FGG(fibrinogen gamma chain) The peptide sequence was selected from the middle region of FGG. Peptide sequence RLTYAYFAGGDAGDAFDGFDFGDDPSDKFFTSHNGMQFSTWDNDNDKFEG.
Clonality
Polyclonal
Host
Rabbit
Gene
FGG
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FGG and was validated on Western blot.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Fibrinogen gamma chain Antibody

  • fibrinogen gamma chain
  • fibrinogen, gamma polypeptide

Background

FGG is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia.The protein encoded by this gene is the gamma component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in this gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia and thrombophilia. Alternative splicing results in two transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33582
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF4409
Species: Mu
Applications: WB
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-45562
Species: Hu
Applications: WB, Flow, IHC
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88114
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
NBP2-52932
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Fibrinogen gamma chain Antibody (NBP1-69287) (0)

There are no publications for Fibrinogen gamma chain Antibody (NBP1-69287).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fibrinogen gamma chain Antibody (NBP1-69287) (0)

There are no reviews for Fibrinogen gamma chain Antibody (NBP1-69287). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fibrinogen gamma chain Antibody (NBP1-69287) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fibrinogen gamma chain Products

Bioinformatics Tool for Fibrinogen gamma chain Antibody (NBP1-69287)

Discover related pathways, diseases and genes to Fibrinogen gamma chain Antibody (NBP1-69287). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fibrinogen gamma chain Antibody (NBP1-69287)

Discover more about diseases related to Fibrinogen gamma chain Antibody (NBP1-69287).
 

Pathways for Fibrinogen gamma chain Antibody (NBP1-69287)

View related products by pathway.

PTMs for Fibrinogen gamma chain Antibody (NBP1-69287)

Learn more about PTMs related to Fibrinogen gamma chain Antibody (NBP1-69287).
 

Research Areas for Fibrinogen gamma chain Antibody (NBP1-69287)

Find related products by research area.

Blogs on Fibrinogen gamma chain.

CD11b Expression, Leukocyte Adhesion and the Innate Immune System
CD11b is an integrin family member which pairs with CD18 to form the CR3 heterodimer. CD11b is expressed on the surface of many leukocytes including monocytes, neutrophils, natural killer cells, granulocytes and macrophages, as well as on 8% of spleen...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fibrinogen gamma chain Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGG
Uniprot