FHIT Antibody

Images

 
Western Blot: FHIT Antibody [NBP1-57079] - Human kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related FHIT Primary Antibodies

Order Details


    • Catalog Number
      NBP1-57079
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FHIT Antibody Summary

Immunogen
Synthetic peptides corresponding to FHIT (fragile histidine triad gene) The peptide sequence was selected from the middle region of FHIT. Peptide sequence VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FHIT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FHIT and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FHIT Antibody

  • AP3A hydrolase
  • AP3AaseFRA3Bbis(5'-adenosyl)-triphosphatase
  • Diadenosine 5'-5'''-P1
  • dinucleosidetriphosphatase
  • EC 3.6.1.29
  • fragile histidine triad gene
  • Fragile histidine triad protein
  • P3-triphosphate hydrolase
  • tumor suppressor protein

Background

This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas. Alternatively spliced transcript variants have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-47579
Species: Hu
Applications: WB, IB, ICC/IF, IHC, IHC-P
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-67381
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56888
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
NBP1-81776
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46024
Species: Hu
Applications: WB, IHC
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-57079
Species: Hu, Mu, Rt, Ca, Eq, GP, Rb, Ze
Applications: WB

Publications for FHIT Antibody (NBP1-57079) (0)

There are no publications for FHIT Antibody (NBP1-57079).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FHIT Antibody (NBP1-57079) (0)

There are no reviews for FHIT Antibody (NBP1-57079). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FHIT Antibody (NBP1-57079) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FHIT Products

Bioinformatics Tool for FHIT Antibody (NBP1-57079)

Discover related pathways, diseases and genes to FHIT Antibody (NBP1-57079). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHIT Antibody (NBP1-57079)

Discover more about diseases related to FHIT Antibody (NBP1-57079).
 

Pathways for FHIT Antibody (NBP1-57079)

View related products by pathway.

PTMs for FHIT Antibody (NBP1-57079)

Learn more about PTMs related to FHIT Antibody (NBP1-57079).
 

Research Areas for FHIT Antibody (NBP1-57079)

Find related products by research area.

Blogs on FHIT

There are no specific blogs for FHIT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FHIT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FHIT
Uniprot