FHIT Antibody (3A5)

Images

 

Product Details

Summary
Product Discontinued
View other related FHIT Primary Antibodies

Order Details


    • Catalog Number
      H00002272-M09
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FHIT Antibody (3A5) Summary

Immunogen
FHIT (AAH32336, 31 a.a. - 130 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VVPGHVLVCPLRPVERFHDLRPDEVADLFQTTQRVGTVVEKHFHGTSLTFSMQDGPEAGQTVKHVHVHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWR
Specificity
FHIT - fragile histidine triad gene
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FHIT
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FHIT Antibody (3A5)

  • AP3A hydrolase
  • AP3AaseFRA3Bbis(5'-adenosyl)-triphosphatase
  • Diadenosine 5'-5'''-P1
  • dinucleosidetriphosphatase
  • EC 3.6.1.29
  • fragile histidine triad gene
  • Fragile histidine triad protein
  • P3-triphosphate hydrolase
  • tumor suppressor protein

Background

This gene, a member of the histidine triad gene family, encodes a diadenosine 5',5'''-P1,P3-triphosphate hydrolase involved in purine metabolism. The gene encompasses the common fragile site FRA3B on chromosome 3, where carcinogen-induced damage can lead to translocations and aberrant transcripts of this gene. In fact, aberrant transcripts from this gene have been found in about half of all esophageal, stomach, and colon carcinomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-33456
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-485
Species: Hu
Applications: WB, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56552
Species: Hu
Applications: WB
AF4885
Species: Mu
Applications: WB, IP
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP1-92025
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002272-M09
Species: Hu
Applications: WB, ELISA

Publications for FHIT Antibody (H00002272-M09) (0)

There are no publications for FHIT Antibody (H00002272-M09).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FHIT Antibody (H00002272-M09) (0)

There are no reviews for FHIT Antibody (H00002272-M09). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FHIT Antibody (H00002272-M09) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FHIT Products

Bioinformatics Tool for FHIT Antibody (H00002272-M09)

Discover related pathways, diseases and genes to FHIT Antibody (H00002272-M09). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FHIT Antibody (H00002272-M09)

Discover more about diseases related to FHIT Antibody (H00002272-M09).
 

Pathways for FHIT Antibody (H00002272-M09)

View related products by pathway.

PTMs for FHIT Antibody (H00002272-M09)

Learn more about PTMs related to FHIT Antibody (H00002272-M09).
 

Research Areas for FHIT Antibody (H00002272-M09)

Find related products by research area.

Blogs on FHIT

There are no specific blogs for FHIT, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FHIT Antibody (3A5) and receive a gift card or discount.

Bioinformatics

Gene Symbol FHIT
Entrez
OMIM
Uniprot