Fgr Antibody (4C12)

Images

 
Immunohistochemistry-Paraffin: Fgr Antibody (4C12) [H00002268-M07] - Analysis of monoclonal antibody to FGR on formalin-fixed paraffin-embedded human spleen. Antibody concentration 3 ug/ml
ELISA: Fgr Antibody (4C12) [H00002268-M07] - Detection limit for recombinant GST tagged FGR is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
4C12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fgr Antibody (4C12) Summary

Immunogen
FGR (AAH64382, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA
Specificity
FGR - Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FGR
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fgr Antibody (4C12)

  • c-fgr
  • c-src-2 proto-oncogene
  • c-src2
  • EC 2.7.10
  • EC 2.7.10.2
  • Fgr
  • FLJ43153
  • Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog
  • MGC75096
  • p55-c-fgr protein
  • p55c-fgr
  • p55-Fgr
  • p58c-fgr
  • Proto-oncogene c-Fgr
  • proto-oncogene tyrosine-protein kinase FGR
  • Src2
  • SRC2c-fgr protooncogene
  • tyrosine-protein kinase Fgr

Background

This gene is a member of the Src family of protein tyrosine kinases (PTKs). The encoded protein contains N-terminal sites for myristylation and palmitylation, a PTK domain, and SH2 and SH3 domains which are involved in mediating protein-protein interactions with phosphotyrosine-containing and proline-rich motifs, respectively. The protein localizes to plasma membrane ruffles, and functions as a negative regulator of cell migration and adhesion triggered by the beta-2 integrin signal transduction pathway. Infection with Epstein-Barr virus results in the overexpression of this gene. Multiple alternatively spliced variants, encoding the same protein, have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
MAB3915
Species: Hu, Mu
Applications: WB
NB500-517
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB7500
Species: Hu
Applications: WB, ICC
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
MAB32051
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00000640-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow
NB200-610
Species: Hu, Ca, GP
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Fgr Antibody (H00002268-M07) (0)

There are no publications for Fgr Antibody (H00002268-M07).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fgr Antibody (H00002268-M07) (0)

There are no reviews for Fgr Antibody (H00002268-M07). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fgr Antibody (H00002268-M07) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fgr Products

Bioinformatics Tool for Fgr Antibody (H00002268-M07)

Discover related pathways, diseases and genes to Fgr Antibody (H00002268-M07). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fgr Antibody (H00002268-M07)

Discover more about diseases related to Fgr Antibody (H00002268-M07).
 

Pathways for Fgr Antibody (H00002268-M07)

View related products by pathway.

PTMs for Fgr Antibody (H00002268-M07)

Learn more about PTMs related to Fgr Antibody (H00002268-M07).
 

Research Areas for Fgr Antibody (H00002268-M07)

Find related products by research area.

Blogs on Fgr

There are no specific blogs for Fgr, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fgr Antibody (4C12) and receive a gift card or discount.

Bioinformatics

Gene Symbol FGR
Entrez
OMIM
Uniprot