FGFR1OP Antibody

Images

 
Western Blot: FGFR1OP Antibody [NBP1-56663] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Human Liver
Immunohistochemistry: FGFR1OP Antibody [NBP1-56663] - Formalin Fixed Paraffin Embedded Tissue: Human Liver Tissue Observed Staining: Cytoplasm in hepatocytes Primary Antibody Concentration: N/A Other Working ...read more

Product Details

Summary
Product Discontinued
View other related FGFR1OP Primary Antibodies

Order Details


    • Catalog Number
      NBP1-56663
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FGFR1OP Antibody Summary

Immunogen
Synthetic peptides corresponding to FGFR1OP(FGFR1 oncogene partner) The peptide sequence was selected from the middle region of FGFR1OP. Peptide sequence LSDVHSPPKSPEGKTSAQTTPSKIPRYKGQGKKKTSGQKAGDKKANDEAN.
Clonality
Polyclonal
Host
Rabbit
Gene
FGFR1OP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against FGFR1OP and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FGFR1OP Antibody

  • FGFR1 oncogene partner
  • FOPfibroblast growth factor receptor 1 oncogene partner

Background

FGFR1OP is a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t (6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage.This gene encodes a largely hydrophilic protein postulated to be a leucine-rich protein family member. A t(6;8)(q27;p11) chromosomal translocation, fusing this gene and the fibroblast growth factor receptor 1 (FGFR1) gene, has been found in cases of myeloproliferative disorder. The resulting chimeric protein contains the N-terminal leucine-rich region of this encoded protein fused to the catalytic domain of FGFR1. This gene is thought to play an important role in normal proliferation and differentiation of the erythroid lineage. Alternatively spliced transcript variants that encode different proteins have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33500
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NB100-56490
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-82458
Species: Hu
Applications: IHC, IHC-P
NB100-59811
Species: Hu, Ca
Applications: WB, ICC/IF, IP
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP1-57508
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-48546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB400-146
Species: Hu, Mu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
AF5414
Species: Hu
Applications: WB, Simple Western
NB100-1269
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-84928
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
44110002
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-49672
Species: Hu
Applications: IHC
H00057804-M01A
Species: Hu
Applications: WB, ELISA
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-56663
Species: Hu
Applications: WB, IHC

Publications for FGFR1OP Antibody (NBP1-56663) (0)

There are no publications for FGFR1OP Antibody (NBP1-56663).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGFR1OP Antibody (NBP1-56663) (0)

There are no reviews for FGFR1OP Antibody (NBP1-56663). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGFR1OP Antibody (NBP1-56663) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGFR1OP Products

Bioinformatics Tool for FGFR1OP Antibody (NBP1-56663)

Discover related pathways, diseases and genes to FGFR1OP Antibody (NBP1-56663). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGFR1OP Antibody (NBP1-56663)

Discover more about diseases related to FGFR1OP Antibody (NBP1-56663).
 

Pathways for FGFR1OP Antibody (NBP1-56663)

View related products by pathway.

PTMs for FGFR1OP Antibody (NBP1-56663)

Learn more about PTMs related to FGFR1OP Antibody (NBP1-56663).
 

Research Areas for FGFR1OP Antibody (NBP1-56663)

Find related products by research area.

Blogs on FGFR1OP

There are no specific blogs for FGFR1OP, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGFR1OP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGFR1OP
Uniprot