Recombinant Human FGF R3 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related FGF R3 Peptides and Proteins

Order Details


    • Catalog Number
      H00002261-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human FGF R3 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human FGFR3 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVT

Protein/Peptide Type
Partial Recombinant Protein
Gene
FGFR3

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FGF R3 Protein

  • CD333
  • CEK
  • EC 2.7.10
  • FGF R3
  • FGFR3
  • fibroblast growth factor receptor 3
  • HSFGFR3EX
  • JTK4
  • JTK4thanatophoric dwarfism

Background

FGFR3 - fibroblast growth factor receptor 3 (achondroplasia, thanatophoric dwarfism)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
AF2265
Species: Mu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-52963
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC

Publications for FGF R3 Partial Recombinant Protein (H00002261-Q01) (0)

There are no publications for FGF R3 Partial Recombinant Protein (H00002261-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF R3 Partial Recombinant Protein (H00002261-Q01) (0)

There are no reviews for FGF R3 Partial Recombinant Protein (H00002261-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF R3 Partial Recombinant Protein (H00002261-Q01). (Showing 1 - 2 of 2 FAQ).

  1. What system is used to synthesize the partial recombinant protein H00002261-Q01?
    • This product has been synthesized in an in-vitro wheat germ expression system.
  2. We have got two questions regarding H00002261-Q01. 1) Is the protein Glycosylated? 2) What concentration of endotoxin has it got and where is it from (source)?
    • This protein is not expected to be glycosylated. It is one we distribute for a Taiwanese company called Abnova. They produce these proteins in a cell free wheat germ system and they are not expected to undergo the exact same PTMs and folding as an endogenous protein. In addition to this they also have a 26 kDa N-Term GST tag on them. Abnova does not measure the endotoxin levels of their proteins. Therefore they will not be able to advise anything on that. We would not recommend them to immunize a mouse, or any animal host. They are mainly intended as WB and ELISA positive controls. Here are details on the protein synthesis.

Additional FGF R3 Products

Bioinformatics Tool for FGF R3 Partial Recombinant Protein (H00002261-Q01)

Discover related pathways, diseases and genes to FGF R3 Partial Recombinant Protein (H00002261-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF R3 Partial Recombinant Protein (H00002261-Q01)

Discover more about diseases related to FGF R3 Partial Recombinant Protein (H00002261-Q01).
 

Pathways for FGF R3 Partial Recombinant Protein (H00002261-Q01)

View related products by pathway.

PTMs for FGF R3 Partial Recombinant Protein (H00002261-Q01)

Learn more about PTMs related to FGF R3 Partial Recombinant Protein (H00002261-Q01).
 

Research Areas for FGF R3 Partial Recombinant Protein (H00002261-Q01)

Find related products by research area.

Blogs on FGF R3

There are no specific blogs for FGF R3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FGF R3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FGFR3
Entrez