FGF R2 Antibody (2C11) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related FGF R2 Primary Antibodies

Order Details


    • Catalog Number
      H00002263-M03PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FGF R2 Antibody (2C11) [PE] Summary

Immunogen
FGFR2 (AAH39243 621 a.a. - 723 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GHRMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYSPSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
Specificity
FGFR2 - fibroblast growth factor receptor 2 (bacteria-expressed kinase, keratinocyte growth factor receptor, craniofacial dysostosis 1, Crouzon syndrome, Pfeiffer syndrome, Jackson-Weiss syndrome)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FGFR2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGF R2 Antibody (2C11) [PE]

  • BBDS
  • BEK
  • BFR-1
  • CD332 antigen
  • CD332
  • CEK3
  • CFD1
  • craniofacial dysostosis 1
  • EC 2.7.10
  • EC 2.7.10.1
  • ECT1
  • FGF R2
  • FGFR2
  • fibroblast growth factor receptor 2
  • FLJ98662
  • Jackson-Weiss syndrome
  • JWS
  • Keratinocyte growth factor receptorreceptor like 14
  • KGFR
  • KSAM
  • K-sam
  • soluble FGFR4 variant 4
  • TK14
  • TK25

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2265
Species: Mu
Applications: WB, IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-87528
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-603
Species: Hu, Mu, Xp
Applications: WB, IHC, IHC-Fr, IHC-P, IP, IF
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
H00002263-M03PE
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for FGF R2 Antibody (H00002263-M03PE) (0)

There are no publications for FGF R2 Antibody (H00002263-M03PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF R2 Antibody (H00002263-M03PE) (0)

There are no reviews for FGF R2 Antibody (H00002263-M03PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FGF R2 Antibody (H00002263-M03PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF R2 Products

Bioinformatics Tool for FGF R2 Antibody (H00002263-M03PE)

Discover related pathways, diseases and genes to FGF R2 Antibody (H00002263-M03PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF R2 Antibody (H00002263-M03PE)

Discover more about diseases related to FGF R2 Antibody (H00002263-M03PE).
 

Pathways for FGF R2 Antibody (H00002263-M03PE)

View related products by pathway.

PTMs for FGF R2 Antibody (H00002263-M03PE)

Learn more about PTMs related to FGF R2 Antibody (H00002263-M03PE).
 

Research Areas for FGF R2 Antibody (H00002263-M03PE)

Find related products by research area.

Blogs on FGF R2

There are no specific blogs for FGF R2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF R2 Antibody (2C11) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol FGFR2
Entrez