Recombinant Human FGF R1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related FGF R1 Peptides and Proteins

Order Details


    • Catalog Number
      H00002260-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human FGF R1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-120 of Human FGFR1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AQPWGAPVEVESFLVHPGDLLQLRCRLRDDVQSINWLRDGVQLAESNRTRITGEEVEVQDSVPADSGLYACVTSSPSGSDTTYFSVNVSDALPSSEDDDDDDDSSSEEKETDNTKPNRMP

Protein/Peptide Type
Partial Recombinant Protein
Gene
FGFR1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FGF R1 Protein

  • basic fibroblast growth factor receptor 1
  • BFGFR
  • bFGF-R-1
  • CD331 antigen
  • CD331
  • CEK
  • EC 2.7.10
  • EC 2.7.10.1
  • FGF R1
  • FGFBR
  • FGFR1
  • FGFR-1
  • fibroblast growth factor receptor 1
  • FLGH3
  • FLJ99988
  • Flt-2
  • FLT2H4
  • Fms-like tyrosine kinase 2
  • fms-related tyrosine kinase 2
  • H2
  • H5
  • HBGFR
  • heparin-binding growth factor receptor
  • hydroxyaryl-protein kinase
  • KAL 2
  • KAL2
  • N-SAM
  • OGD
  • Proto-oncogene c-Fgr
  • soluble FGFR1 variant 1
  • soluble FGFR1 variant 2

Background

FGFR1 - fibroblast growth factor receptor 1 (fms-related tyrosine kinase 2, Pfeiffer syndrome)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
232-FA/CF
Species: Hu
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2265
Species: Mu
Applications: WB, IHC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-76580
Species: Hu
Applications: WB, ELISA, ICC/IF, ICC
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
AF385
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut

Publications for FGF R1 Partial Recombinant Protein (H00002260-Q01) (0)

There are no publications for FGF R1 Partial Recombinant Protein (H00002260-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF R1 Partial Recombinant Protein (H00002260-Q01) (0)

There are no reviews for FGF R1 Partial Recombinant Protein (H00002260-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF R1 Partial Recombinant Protein (H00002260-Q01). (Showing 1 - 2 of 2 FAQ).

  1. I would like to inquire whether you have samples of the following antibodies: NBP1-61338, NB600-1287, NBP1-19481, NBP1-19864; The datasheets for these antibodies show different molecular weights of the detected proteins so its no altogether clear to me which one detects the real protein. To sort this out, we would be using FGFR1-deficient cells and would very much appreciate if you could supply us with small aliquots of these antibodies.
    • FGFR1 has multiple isoforms and is subject to multiple PTM's. The molecular weight can vary greatly depending on experimental conditions and samples used. We fully guarantee all of our products for the listed applications and species. If you cannot get a product to work in an application or species stated on our datasheet, our technical service team will troubleshoot with you to get it to work. If a product still does not work after troubleshooting, you can receive a free of charge replacement product or a full refund. Due to our 100% guarantee, we do not offer free of charge samples of our products. If a smaller sample size is available, it will be listed on our product page.
  2. I am working in Multiple sclerosis group and mainly working with mice model and cell culture study. I need FGFR1 antibody against Mice for FACS analysis. If it is available can I get the sample to check with my cells? And any Oligodendrocyte markers against mice for FACS too.
    • We do have an antibody that has been tested in FLOW, NB600-1287, however it has not been tested in mouse. If you would like to test this antibody in mouse samples we have an Innovators Reward Program where we reward you for trying our antibody in species and applications that have not been previously tested.

Additional FGF R1 Products

Bioinformatics Tool for FGF R1 Partial Recombinant Protein (H00002260-Q01)

Discover related pathways, diseases and genes to FGF R1 Partial Recombinant Protein (H00002260-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF R1 Partial Recombinant Protein (H00002260-Q01)

Discover more about diseases related to FGF R1 Partial Recombinant Protein (H00002260-Q01).
 

Pathways for FGF R1 Partial Recombinant Protein (H00002260-Q01)

View related products by pathway.

PTMs for FGF R1 Partial Recombinant Protein (H00002260-Q01)

Learn more about PTMs related to FGF R1 Partial Recombinant Protein (H00002260-Q01).
 

Research Areas for FGF R1 Partial Recombinant Protein (H00002260-Q01)

Find related products by research area.

Blogs on FGF R1

There are no specific blogs for FGF R1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FGF R1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FGFR1
Entrez