FGF acidic/FGF1 Antibody


Western Blot: FGF1 Antibody [NBP1-68925] - Rat Kidney lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related FGF acidic/FGF1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FGF acidic/FGF1 Antibody Summary

Synthetic peptides corresponding to Fgf1 (fibroblast growth factor 1) The peptide sequence was selected from the N terminal of Fgf1. Peptide sequence MAEGEITTFAALTERFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTR.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Fgf1 and was validated on Western blot.
Theoretical MW
17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FGF acidic/FGF1 Antibody

  • AFGF
  • alpha
  • alpha-ECGF
  • beta-ECGF
  • ECGF
  • ECGF-betaAcidic fibroblast growth factor
  • endothelial cell growth factor, beta
  • FGF acidic
  • FGF1
  • FGF-1
  • FGFABeta-endothelial cell growth factor
  • FGF-alpha
  • fibroblast growth factor 1 (acidic)
  • GLIO703
  • HBGF1
  • HBGF-1
  • heparin-binding growth factor 1


The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC

Publications for FGF acidic/FGF1 Antibody (NBP1-68925) (0)

There are no publications for FGF acidic/FGF1 Antibody (NBP1-68925).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF acidic/FGF1 Antibody (NBP1-68925) (0)

There are no reviews for FGF acidic/FGF1 Antibody (NBP1-68925). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF acidic/FGF1 Antibody (NBP1-68925) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FGF acidic/FGF1 Products

Bioinformatics Tool for FGF acidic/FGF1 Antibody (NBP1-68925)

Discover related pathways, diseases and genes to FGF acidic/FGF1 Antibody (NBP1-68925). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF acidic/FGF1 Antibody (NBP1-68925)

Discover more about diseases related to FGF acidic/FGF1 Antibody (NBP1-68925).

Pathways for FGF acidic/FGF1 Antibody (NBP1-68925)

View related products by pathway.

PTMs for FGF acidic/FGF1 Antibody (NBP1-68925)

Learn more about PTMs related to FGF acidic/FGF1 Antibody (NBP1-68925).

Blogs on FGF acidic/FGF1

There are no specific blogs for FGF acidic/FGF1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FGF acidic/FGF1 Antibody and receive a gift card or discount.


Gene Symbol FGF1