FGF acidic/FGF1 Antibody (1F9)

Images

 
Immunocytochemistry/ Immunofluorescence: FGF acidic/FGF1 Antibody (1F9) [H00002246-M03] - Analysis of monoclonal antibody to FGF1 on HeLa cell. Antibody concentration 10 ug/ml
Immunohistochemistry-Paraffin: FGF acidic/FGF1 Antibody (1F9) [H00002246-M03] - Analysis of monoclonal antibody to FGF1 on formalin-fixed paraffin-embedded human spleen. Antibody concentration 3 ug/ml
Sandwich ELISA: FGF acidic/FGF1 Antibody (1F9) [H00002246-M03] - Detection limit for recombinant GST tagged FGF1 is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC-P
Clone
1F9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FGF acidic/FGF1 Antibody (1F9) Summary

Immunogen
FGF1 (AAH32697, 46 a.a. - 155 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Specificity
fibroblast growth factor 1 (acidic)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FGF1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGF acidic/FGF1 Antibody (1F9)

  • AFGF
  • alpha
  • alpha-ECGF
  • beta-ECGF
  • ECGF
  • ECGFB
  • ECGF-betaAcidic fibroblast growth factor
  • endothelial cell growth factor, beta
  • FGF acidic
  • FGF1
  • FGF-1
  • FGFABeta-endothelial cell growth factor
  • FGF-alpha
  • fibroblast growth factor 1 (acidic)
  • GLIO703
  • HBGF1
  • HBGF-1
  • heparin-binding growth factor 1

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Three alternatively spliced variants encoding different isoforms have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2265
Species: Mu
Applications: WB, IHC

Publications for FGF acidic/FGF1 Antibody (H00002246-M03) (0)

There are no publications for FGF acidic/FGF1 Antibody (H00002246-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF acidic/FGF1 Antibody (H00002246-M03) (0)

There are no reviews for FGF acidic/FGF1 Antibody (H00002246-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FGF acidic/FGF1 Antibody (H00002246-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF acidic/FGF1 Products

Bioinformatics Tool for FGF acidic/FGF1 Antibody (H00002246-M03)

Discover related pathways, diseases and genes to FGF acidic/FGF1 Antibody (H00002246-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF acidic/FGF1 Antibody (H00002246-M03)

Discover more about diseases related to FGF acidic/FGF1 Antibody (H00002246-M03).
 

Pathways for FGF acidic/FGF1 Antibody (H00002246-M03)

View related products by pathway.

PTMs for FGF acidic/FGF1 Antibody (H00002246-M03)

Learn more about PTMs related to FGF acidic/FGF1 Antibody (H00002246-M03).
 

Research Areas for FGF acidic/FGF1 Antibody (H00002246-M03)

Find related products by research area.

Blogs on FGF acidic/FGF1

There are no specific blogs for FGF acidic/FGF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF acidic/FGF1 Antibody (1F9) and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF1
Entrez
OMIM
Uniprot