FGF-23 Antibody

Images

 
Western Blot: FGF-23 Antibody [H00008074-B01P] - Analysis of FGF23 expression in transfected 293T cell line by FGF23 polyclonal antibody. Lane 1: FGF23 transfected lysate(27.61 KDa). Lane 2: Non-transfected lysate.
Proximity Ligation Assay: FGF-23 Antibody [H00008074-B01P] - Analysis of protein-protein interactions between FGFR2 and FGF23. HeLa cells were stained with anti-FGFR2 rabbit purified polyclonal 1:1200 and anti-FGF23 ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, PLA
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FGF-23 Antibody Summary

Immunogen
FGF23 (NP_065689.1, 1 a.a. - 251 a.a.) full-length human protein. MLGARLRLWVCALCSVCSMSVLRAYPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI
Specificity
FGF23 - fibroblast growth factor 23,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
FGF23
Purity
Unpurified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Unpurified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FGF-23 Antibody

  • ADHR
  • FGF23
  • FGF-23
  • fibroblast growth factor 23
  • HPDR2
  • HYPF
  • phosphatonin
  • PHPTC
  • tumor-derived hypophosphatemia inducing factor
  • Tumor-derived hypophosphatemia-inducing factor

Background

The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. The product of this gene inhibits renal tubular phosphate transport. This gene was identified by its mutations associated with autosomal dominant hypophosphatemic rickets (ADHR), an inherited phosphate wasting disorder. Abnormally high level expression of this gene was found in oncogenic hypophosphatemic osteomalacia (OHO), a phenotypically similar disease caused by abnormal phosphate metabolism. Mutations in this gene have also been shown to cause familial tumoral calcinosis with hyperphosphatemia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35213
Species: Hu
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
8090-ZN
Species: Hu
NBP1-76511
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-45525
Species: Hu, Mu, Rt
Applications: WB
H00009988-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7174
Species: Hu
Applications: WB, ICC
H00009771-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-29942
Species: Hu
Applications: WB, Flow, IHC-P
AF6150
Species: Mu
Applications: WB
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52557
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, IF
NBP2-42216
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
1827-SF/CF
Species: Hu
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-81933
Species: Hu
Applications: IHC, IHC-P
H00008074-B01P
Species: Hu
Applications: WB, PLA

Publications for FGF-23 Antibody (H00008074-B01P) (0)

There are no publications for FGF-23 Antibody (H00008074-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FGF-23 Antibody (H00008074-B01P) (0)

There are no reviews for FGF-23 Antibody (H00008074-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FGF-23 Antibody (H00008074-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF-23 Products

Bioinformatics Tool for FGF-23 Antibody (H00008074-B01P)

Discover related pathways, diseases and genes to FGF-23 Antibody (H00008074-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-23 Antibody (H00008074-B01P)

Discover more about diseases related to FGF-23 Antibody (H00008074-B01P).
 

Pathways for FGF-23 Antibody (H00008074-B01P)

View related products by pathway.

PTMs for FGF-23 Antibody (H00008074-B01P)

Learn more about PTMs related to FGF-23 Antibody (H00008074-B01P).
 

Research Areas for FGF-23 Antibody (H00008074-B01P)

Find related products by research area.

Blogs on FGF-23

There are no specific blogs for FGF-23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF-23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF23
Entrez