FGF-13 Antibody

Images

 
Western Blot: FGF-13 Antibody [NBP1-84689] - Analysis in control (vector only transfected HEK293T lysate) and fGF13 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: FGF-13 Antibody [NBP1-84689] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: FGF-13 Antibody [NBP1-84689] - Staining of human hippocampus shows strong nucleolar and cytoplasmic positivity in neuronal cells.

Product Details

Summary
Product Discontinued
View other related FGF-13 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-84689
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FGF-13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STYTLFNLIPVGLRVVAIQGVQTKLYLAMNSEGYLYTSELFTPECKFKESVFENYYVTYSSMIYRQQQSGRGWYLGLNKEGEIMKGNHVKKNKPAAHFLPKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNES
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FGF13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Publications
Read Publication using
NBP1-84689 in the following applications:

  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 26063919).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FGF-13 Antibody

  • FGF13
  • FGF-13
  • FGF2Fibroblast growth factor homologous factor 2
  • FHF2FHF-2
  • fibroblast growth factor 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
232-FA/CF
Species: Hu
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB766
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
423-F8/CF
Species: Hu, Mu
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
NBP1-84689
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FGF-13 Antibody (NBP1-84689)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for FGF-13 Antibody (NBP1-84689) (0)

There are no reviews for FGF-13 Antibody (NBP1-84689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FGF-13 Antibody (NBP1-84689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FGF-13 Products

Bioinformatics Tool for FGF-13 Antibody (NBP1-84689)

Discover related pathways, diseases and genes to FGF-13 Antibody (NBP1-84689). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FGF-13 Antibody (NBP1-84689)

Discover more about diseases related to FGF-13 Antibody (NBP1-84689).
 

Pathways for FGF-13 Antibody (NBP1-84689)

View related products by pathway.

PTMs for FGF-13 Antibody (NBP1-84689)

Learn more about PTMs related to FGF-13 Antibody (NBP1-84689).
 

Research Areas for FGF-13 Antibody (NBP1-84689)

Find related products by research area.

Blogs on FGF-13

There are no specific blogs for FGF-13, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FGF-13 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FGF13
Entrez