Fetuin A/AHSG Antibody (5D8)

Images

 
ELISA: Fetuin A/AHSG Antibody (5D8) [H00000197-M01] - Detection limit for recombinant GST tagged AHSG is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5D8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fetuin A/AHSG Antibody (5D8) Summary

Immunogen
AHSG (AAH48198.1, 19 a.a. - 367 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. APHGPGLIYRQPNCDDPETEEAALVAIDYINQNLPWGYKHTLNQIDEVKVWPQQPSGELFEIEIDTLETTCHVLDPTPVARCSVRQLKEHAVEGDCDFQLLKLDGKFSVVYAKCDSSPDSAEDVRKVCQDCPLLAPLNDTRVVHAAKAALAAFNAQNNGSNFQLEEISRAQLVPLPPSTYVEFTVSGTDCVAKEATEAAKCNLLAEKQYGFCKATLSEKLGGAEVAVTCTVFQTQPVTSQPQPEGANEAVPTPVVDPDAPPSPPLGAPGLPPAGSPPDSHVLLAAPPGHQLHRAHYDLRHTFMGVVSLGSPSGEVSHPRKTRTVVQPSVGAAAGPVVPPCPGRIRHFKV
Specificity
AHSG - alpha-2-HS-glycoprotein
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
AHSG
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00000197-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fetuin A/AHSG Antibody (5D8)

  • A2HS
  • AHS
  • AHSG
  • alpha-2-HS-glycoprotein
  • alpha-2-Z-globulin
  • Ba-alpha-2-glycoprotein
  • FETUAba-alpha-2-glycoprotein
  • Fetuin A
  • fetuin-A
  • HSGA

Background

Alpha2-HS glycoprotein (AHSG), a glycoprotein present in the serum, is synthesized by hepatocytes. The AHSG molecule consists of two polypeptide chains, which are both cleaved from a proprotein encoded from a single mRNA. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix, and it has therefore been postulated that it participates in the development of the tissues. However, its exact significance is still obscure.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56505
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF808
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP2-35213
Species: Hu
AF5739
Species: Hu, Mu, Rt
Applications: WB
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6146
Species: Hu
Applications: ICC
NB500-418
Species: Hu, Po, Rb
Applications: WB, B/N, ELISA, ICC/IF, IHC, IHC-P, RIA
AF4409
Species: Mu
Applications: WB
NBP2-45844
Species: Hu
Applications: WB, IHC
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
2629-FG/CF
Species: Mu
MAB3694
Species: Hu
Applications: WB, IHC
NB100-56703
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr

Publications for Fetuin A/AHSG Antibody (H00000197-M01)(1)

Reviews for Fetuin A/AHSG Antibody (H00000197-M01) (0)

There are no reviews for Fetuin A/AHSG Antibody (H00000197-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fetuin A/AHSG Antibody (H00000197-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fetuin A/AHSG Products

Bioinformatics Tool for Fetuin A/AHSG Antibody (H00000197-M01)

Discover related pathways, diseases and genes to Fetuin A/AHSG Antibody (H00000197-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fetuin A/AHSG Antibody (H00000197-M01)

Discover more about diseases related to Fetuin A/AHSG Antibody (H00000197-M01).
 

Pathways for Fetuin A/AHSG Antibody (H00000197-M01)

View related products by pathway.

PTMs for Fetuin A/AHSG Antibody (H00000197-M01)

Learn more about PTMs related to Fetuin A/AHSG Antibody (H00000197-M01).
 

Research Areas for Fetuin A/AHSG Antibody (H00000197-M01)

Find related products by research area.

Blogs on Fetuin A/AHSG

There are no specific blogs for Fetuin A/AHSG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fetuin A/AHSG Antibody (5D8) and receive a gift card or discount.

Bioinformatics

Gene Symbol AHSG
Entrez
OMIM
Uniprot