Ferritin mitochondrial Antibody - Azide and BSA Free

Western Blot: Ferritin mitochondrial Antibody [NBP3-03534] - Analysis of extracts of Mouse testis, using Ferritin mitochondrial antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Ferritin mitochondrial Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit Ferritin mitochondrial Antibody - Azide and BSA Free (NBP3-03534) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 183-242 of human Ferritin mitochondrial (NP_803431.1). DKGDPHLCDFLETYYLNEQVKSIKELGDHVHNLVKMGAPDAGLAEYLFDTHTLGNENKQN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: FTMT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 27 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for Ferritin mitochondrial Antibody - Azide and BSA Free

• EC 1.16.3.1
• ferritin H subunit
• ferritin mitochondrial
• ferritin, mitochondrial
• mitochondrial ferritin
• MTF

Background

Stores iron in a soluble, non-toxic, readily available form. Important for iron homeostasis. Has ferroxidaseactivity. Iron is taken up in the ferrous form and deposited as ferric hydroxides after oxidation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: FTMT