We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Fer Recombinant Protein Antigen

Images

 
There are currently no images for Fer Protein (NBP1-86894PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Fer Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FER.

Source: E. coli

Amino Acid Sequence: QVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FER
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86894.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Fer Recombinant Protein Antigen

  • EC 2.7.10
  • EC 2.7.10.2
  • fer (fps/fes related) tyrosine kinase
  • Fer
  • p94-Fer
  • Phosphoprotein NCP94
  • Proto-oncogene c-Fer
  • TYK3
  • TYK3phosphoprotein NCP94
  • Tyrosine kinase 3
  • tyrosine-protein kinase Fer

Background

Protein kinases constitute a large superfamily of enzymes with key regulatory functions in nearly all signal transmission processes of eukaryotic cells (1). FER is found in the cytoplasm and in the nucleus, where it was associated with the chromatin fraction. Its ubiquitous expression and its subcellular location indicate that it may be involved in key regulatory processes (2). The group IV cytoplasmic protein-tyrosine kinase Fer has been linked to cellular signaling responses to many different stimuli, including growth factors and cytokines. Data suggest a biological role for Fer in regulation of leukocyte recruitment during the innate immune response (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6460
Species: Hu
Applications: IHC, WB
MAB812
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-37737
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
NBP2-15971
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP2-16463
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
202-IL
Species: Hu
Applications: BA
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
2914-HT
Species: Hu
Applications: BA
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP3-38370
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
255-SC
Species: Hu
Applications: BA
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
MEP00B
Species: Mu
Applications: ELISA
MAB1799
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
DY1707
Species: Hu
Applications: ELISA
NBP2-24589
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC,  IHC-P, KO, Simple Western, WB
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, IHC, Simple Western, WB
MAB6210
Species: Hu
Applications: Simple Western, WB

Publications for Fer Protein (NBP1-86894PEP) (0)

There are no publications for Fer Protein (NBP1-86894PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fer Protein (NBP1-86894PEP) (0)

There are no reviews for Fer Protein (NBP1-86894PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Fer Protein (NBP1-86894PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Fer Products

Array NBP1-86894PEP

Research Areas for Fer Protein (NBP1-86894PEP)

Find related products by research area.

Blogs on Fer

There are no specific blogs for Fer, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Fer Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FER