Recombinant Human FCRLB/FCRY Protein

Images

 

Product Details

Summary
Product Discontinued
View other related FCRLB/FCRY Peptides and Proteins

Order Details


    • Catalog Number
      H00127943-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human FCRLB/FCRY Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 89 - 174 of Human FCRLM2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:DSLASCKAGAASPILGCRTRAECQSGCDMKRLAWSLFLSSFPRPSWTRSPCPTFQKAPLPPPRGHTASSPPPLVCGSARSPRGKQE

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
FCRLB

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FCRLB/FCRY Protein

  • Fc receptor homolog expressed in B cells protein 2
  • Fc receptor like 2
  • Fc receptor-like and mucin-like 2
  • Fc receptor-like and mucin-like protein 2
  • Fc receptor-like B
  • Fc receptor-like protein 2
  • Fc receptor-related protein Y
  • FcRL2
  • FCRL2FCRLM2
  • FCRLB
  • FCRLM2
  • FCRLY
  • FCRY
  • FLJ31052
  • FREB2
  • FREB-2
  • FREB-2FcRY
  • RP11-474I16.6

Background

FCRL2 belongs to the Fc receptor family. Fc receptors are involved in phagocytosis, antibody-dependent cell cytotoxicity, immediate hypersensitivity, and transcytosis of immunoglobulins via their ability to bind immunoglobulin (Ig) constant regions (Chikaev et al., 2005 [PubMed 15676285]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7905
Species: Mu
Applications: WB, Flow, CyTOF-ready
AF3126
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-84703
Species: Hu
Applications: IHC, IHC-P
AF2426
Species: Hu
Applications: WB, IHC
AF2087
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-89128
Species: Hu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-65338
Species: Hu, Po, Ca, Pm
Applications: Flow, IHC, IHC-Fr, IP
NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
MAB5018
Species: Hu
Applications: WB, IP
MAB19081
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-76770
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, ICC
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready

Publications for FCRLB/FCRY Partial Recombinant Protein (H00127943-Q01) (0)

There are no publications for FCRLB/FCRY Partial Recombinant Protein (H00127943-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCRLB/FCRY Partial Recombinant Protein (H00127943-Q01) (0)

There are no reviews for FCRLB/FCRY Partial Recombinant Protein (H00127943-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FCRLB/FCRY Partial Recombinant Protein (H00127943-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FCRLB/FCRY Products

Bioinformatics Tool for FCRLB/FCRY Partial Recombinant Protein (H00127943-Q01)

Discover related pathways, diseases and genes to FCRLB/FCRY Partial Recombinant Protein (H00127943-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCRLB/FCRY Partial Recombinant Protein (H00127943-Q01)

Discover more about diseases related to FCRLB/FCRY Partial Recombinant Protein (H00127943-Q01).
 

Pathways for FCRLB/FCRY Partial Recombinant Protein (H00127943-Q01)

View related products by pathway.

Blogs on FCRLB/FCRY

There are no specific blogs for FCRLB/FCRY, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FCRLB/FCRY Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FCRLB
Entrez