Recombinant Human FCAR/CD89 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related FCAR/CD89 Peptides and Proteins

Order Details


    • Catalog Number
      H00002204-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human FCAR/CD89 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-110 of Human FCAR partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GDFPMPFISAKSSPVIPLDGSVKIQCQAIREAYLTQLMIIKNSTYREIGRRLKFWNETDPEFVIDHMDANKAGRYQCQYRIGHYRFRYSDTLELVVTGLYGKPFLSADRG

Protein/Peptide Type
Partial Recombinant Protein
Gene
FCAR

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human FCAR/CD89 Protein

  • CD89 antigen
  • CD89
  • CD89IgA Fc receptor
  • Fc alpha receptor
  • Fc fragment of IgA, receptor for
  • FCAR
  • immunoglobulin alpha Fc receptor

Background

FCAR - Fc fragment of IgA, receptor for

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-16456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB100-65338
Species: Hu, Po, Ca, Pm
Applications: Flow, IHC, IHC-Fr, IP
AF1875
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready

Publications for FCAR/CD89 Partial Recombinant Protein (H00002204-Q01) (0)

There are no publications for FCAR/CD89 Partial Recombinant Protein (H00002204-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCAR/CD89 Partial Recombinant Protein (H00002204-Q01) (0)

There are no reviews for FCAR/CD89 Partial Recombinant Protein (H00002204-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FCAR/CD89 Partial Recombinant Protein (H00002204-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional FCAR/CD89 Products

Bioinformatics Tool for FCAR/CD89 Partial Recombinant Protein (H00002204-Q01)

Discover related pathways, diseases and genes to FCAR/CD89 Partial Recombinant Protein (H00002204-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCAR/CD89 Partial Recombinant Protein (H00002204-Q01)

Discover more about diseases related to FCAR/CD89 Partial Recombinant Protein (H00002204-Q01).
 

Pathways for FCAR/CD89 Partial Recombinant Protein (H00002204-Q01)

View related products by pathway.

Blogs on FCAR/CD89

There are no specific blogs for FCAR/CD89, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human FCAR/CD89 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol FCAR
Entrez