FCAR/CD89 Antibody


Western Blot: FCAR/CD89 Antibody [NBP1-88102] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)Lane 5: Human ...read more
Immunocytochemistry/ Immunofluorescence: FCAR/CD89 Antibody [NBP1-88102] - Staining of human cell line U-251MG shows positivity in plasma membrane.
Immunohistochemistry: FCAR/CD89 Antibody [NBP1-88102] - Staining of human skin melanoma shows moderate cytoplasmic localization. Female, age 104
Immunohistochemistry-Paraffin: FCAR/CD89 Antibody [NBP1-88102] - Staining of human lymph node shows moderate cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Immunohistochemistry: FCAR/CD89 Antibody [NBP1-88102] - Staining of human brain shows moderate cytoplasmic positivity. Male, age 48
Simple Western: FCAR/CD89 Antibody [NBP1-88102] - Simple Western lane view shows a specific band for FCAR in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: FCAR/CD89 Antibody [NBP1-88102] - Electropherogram image(s) of corresponding Simple Western lane view. FCAR/CD89 antibody was used at 1:4 dilution on Liver lysate(s).

Product Details

Reactivity HuSpecies Glossary
Applications WB, Simple Western, ICC/IF, IHC, IHC-P
Concentrations vary lot to lot. See vial label for concentration. If unlisted please contact technical services.

Order Details

FCAR/CD89 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:NWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified


  • Western Blot 1:100 - 1:250
  • Simple Western 1:10
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100. In Simple Western only 10-15 uL of the recommended dilution is used per data point.
Control Peptide
FCAR/CD89 Protein (NBP1-88102PEP)

Alternate Names for FCAR/CD89 Antibody

  • CD89 antigen
  • CD89
  • CD89IgA Fc receptor
  • Fc alpha receptor
  • Fc fragment of IgA, receptor for
  • immunoglobulin alpha Fc receptor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no publications for FCAR/CD89 Antibody (NBP1-88102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no reviews for FCAR/CD89 Antibody (NBP1-88102). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FCAR/CD89 Antibody Products

Related Products by Gene

Bioinformatics Tool for FCAR/CD89 Antibody (NBP1-88102)

Discover related pathways, diseases and genes to FCAR/CD89 Antibody (NBP1-88102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCAR/CD89 Antibody (NBP1-88102)

Discover more about diseases related to FCAR/CD89 Antibody (NBP1-88102).

Pathways for FCAR/CD89 Antibody (NBP1-88102)

View related products by pathway.

Blogs on FCAR/CD89

There are no specific blogs for FCAR/CD89, but you can read our latest blog posts.

Contact Information

Product PDFs


Gene Symbol FCAR

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-88102 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought