FCAR/CD89 Antibody


Immunocytochemistry/ Immunofluorescence: FCAR/CD89 Antibody [NBP1-88102] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FCAR/CD89 Antibody [NBP1-88102] - Staining of human lymph node shows moderate cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Simple Western: FCAR/CD89 Antibody [NBP1-88102] - Simple Western lane view shows a specific band for FCAR in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: FCAR/CD89 Antibody [NBP1-88102] - Electropherogram image(s) of corresponding Simple Western lane view. FCAR/CD89 antibody was used at 1:4 dilution on Liver lysate(s).

Product Details

Reactivity HuSpecies Glossary
Applications Simple Western, ICC/IF, IHC, IHC-P

Order Details

FCAR/CD89 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: NWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK
Specificity of human FCAR/CD89 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Simple Western 1:10
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
FCAR/CD89 Protein (NBP1-88102PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for FCAR/CD89 Antibody

  • CD89 antigen
  • CD89
  • CD89IgA Fc receptor
  • Fc alpha receptor
  • Fc fragment of IgA, receptor for
  • FCAR
  • immunoglobulin alpha Fc receptor


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
Species: Hu
Applications: Flow, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Po, Ca, Pm
Applications: Flow, IHC, IHC-Fr, IP
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready, ICC

Publications for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no publications for FCAR/CD89 Antibody (NBP1-88102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no reviews for FCAR/CD89 Antibody (NBP1-88102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FCAR/CD89 Products

Bioinformatics Tool for FCAR/CD89 Antibody (NBP1-88102)

Discover related pathways, diseases and genes to FCAR/CD89 Antibody (NBP1-88102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCAR/CD89 Antibody (NBP1-88102)

Discover more about diseases related to FCAR/CD89 Antibody (NBP1-88102).

Pathways for FCAR/CD89 Antibody (NBP1-88102)

View related products by pathway.

Blogs on FCAR/CD89

There are no specific blogs for FCAR/CD89, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FCAR/CD89 Antibody and receive a gift card or discount.


Gene Symbol FCAR