FCAR/CD89 Antibody

Images

 
Western Blot: FCAR/CD89 Antibody [NBP1-88102] - Analysis in control (vector only transfected HEK293T lysate) and FCAR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Immunocytochemistry/ Immunofluorescence: FCAR/CD89 Antibody [NBP1-88102] - Staining of human cell line U-251 MG shows localization to plasma membrane. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: FCAR/CD89 Antibody [NBP1-88102] - Staining of human liver shows moderate cytoplasmic positivity in Kupffer cells.
Immunohistochemistry-Paraffin: FCAR/CD89 Antibody [NBP1-88102] - Staning of human lung shows strong cytoplasmic positivity in macrophages.
Immunohistochemistry-Paraffin: FCAR/CD89 Antibody [NBP1-88102] - Staining of human tonsil shows moderate cytoplasmic positivity in lymphoid cells.
Immunohistochemistry-Paraffin: FCAR/CD89 Antibody [NBP1-88102] - Staining of human small intestine shows strong cytoplasmic positivity in lymphoid cells.
Simple Western: FCAR/CD89 Antibody [NBP1-88102] - Simple Western lane view shows a specific band for FCAR in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: FCAR/CD89 Antibody [NBP1-88102] - Electropherogram image(s) of corresponding Simple Western lane view. FCAR/CD89 antibody was used at 1:4 dilution on Liver lysate(s).

Product Details

Summary
Product Discontinued
View other related FCAR/CD89 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-88102
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FCAR/CD89 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCAR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Simple Western 1:10
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FCAR/CD89 Antibody

  • CD89 antigen
  • CD89
  • CD89IgA Fc receptor
  • Fc alpha receptor
  • Fc fragment of IgA, receptor for
  • FCAR
  • immunoglobulin alpha Fc receptor

Background

The CD89 gene is a member of the immunoglobulin gene superfamily and encodes a receptor for the Fc region of IgA. Thereceptor is a transmembrane glycoprotein present on the surface of myeloid lineage cells such as neutrophils,monocytes, macrophages, and eosin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
7268-CT
Species: Hu
Applications: BA
NBP2-61794
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
1257-FC
Species: Hu
Applications: Bind
M6000B
Species: Mu
Applications: ELISA
NB110-89474
Species: Bv, Ce, ChHa, Hu, Pm, Mu, Rt, RM
Applications: Dual ISH-IHC, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, ISH, Simple Western, Single-Cell Western, WB
4325-FC
Species: Hu
Applications: Bind
AF1597
Species: Hu
Applications: Block, Simple Western, WB
7954-GM/CF
Species: Hu
Applications: BA
NBP3-25463
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
202-IL
Species: Hu
Applications: BA
NB100-92243
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PLA, WB
DY417
Species: Mu
Applications: ELISA
AF1330
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, WB

Publications for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no publications for FCAR/CD89 Antibody (NBP1-88102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no reviews for FCAR/CD89 Antibody (NBP1-88102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FCAR/CD89 Products

Research Areas for FCAR/CD89 Antibody (NBP1-88102)

Find related products by research area.

Blogs on FCAR/CD89

There are no specific blogs for FCAR/CD89, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FCAR/CD89 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCAR