FCAR/CD89 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: FCAR/CD89 Antibody [NBP1-88102] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane.
Immunohistochemistry-Paraffin: FCAR/CD89 Antibody [NBP1-88102] - Staining of human lymph node shows moderate cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
Simple Western: FCAR/CD89 Antibody [NBP1-88102] - Simple Western lane view shows a specific band for FCAR in 0.2 mg/ml of Liver lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Simple Western: FCAR/CD89 Antibody [NBP1-88102] - Electropherogram image(s) of corresponding Simple Western lane view. FCAR/CD89 antibody was used at 1:4 dilution on Liver lysate(s).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications Simple Western, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FCAR/CD89 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NWHSHTALNKEASADVAEPSWSQQMCQPGLTFARTPSVCK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCAR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Simple Western 1:10
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
FCAR/CD89 Protein (NBP1-88102PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FCAR/CD89 Antibody

  • CD89 antigen
  • CD89
  • CD89IgA Fc receptor
  • Fc alpha receptor
  • Fc fragment of IgA, receptor for
  • FCAR
  • immunoglobulin alpha Fc receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-89474
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-27946
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
MAB2546
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-16456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NB100-65338
Species: Hu, Po, Ca, Pm
Applications: Flow, IHC, IHC-Fr, IP
AF1875
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready

Publications for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no publications for FCAR/CD89 Antibody (NBP1-88102).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no reviews for FCAR/CD89 Antibody (NBP1-88102). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for FCAR/CD89 Antibody (NBP1-88102) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FCAR/CD89 Products

Bioinformatics Tool for FCAR/CD89 Antibody (NBP1-88102)

Discover related pathways, diseases and genes to FCAR/CD89 Antibody (NBP1-88102). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FCAR/CD89 Antibody (NBP1-88102)

Discover more about diseases related to FCAR/CD89 Antibody (NBP1-88102).
 

Pathways for FCAR/CD89 Antibody (NBP1-88102)

View related products by pathway.

Blogs on FCAR/CD89

There are no specific blogs for FCAR/CD89, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FCAR/CD89 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCAR
Entrez