Fc epsilon RI Antibody

Images

 
Western Blot: Fc epsilon RI Antibody [NBP1-59074] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related Fc epsilon RI Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59074
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Fc epsilon RI Antibody Summary

Immunogen
Synthetic peptides corresponding to FCER1A(Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide) The peptide sequence was selected from the middle region of FCER1A. Peptide sequence IYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKVWQLD
Specificity
This product is specific to Subunit or Isoform: alpha.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCER1A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against FCER1A and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Fc epsilon RI Antibody

  • alpha polypeptide
  • Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide
  • Fc-epsilon RI-alpha
  • FcERI
  • high affinity immunoglobulin epsilon receptor alpha-subunit
  • high affinity immunoglobulin epsilon receptor subunit alpha
  • high-affinity, of mast cells, alpha polypeptide

Background

The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule. A perturbation occurs that brings about the release of histamine and proteases from the granules in the cytoplasm of the mast cell and leads to the synthesis of prostaglandins and leukotrienes--potent effectors of the hypersensitivity response. The IgE receptor consists of 3 subunits: alpha, beta (MIM 147138), and gamma (MIM 147139); only the alpha subunit is glycosylated.The IgE receptor plays a central role in allergic disease, coupling allergen and mast cell to initiate the inflammatory and immediate hypersensitivity responses that are characteristic of disorders such as hay fever and asthma. The allergic response occurs when 2 or more high-affinity IgE receptors are crosslinked via IgE molecules that in turn are bound to an allergen (antigen) molecule. A perturbation occurs that brings about the release of histamine and proteases from the granules in the cytoplasm of the mast cell and leads to the synthesis of prostaglandins and leukotrienes--potent effectors of the hypersensitivity response. The IgE receptor consists of 3 subunits: alpha, beta (MIM 147138), and gamma (MIM 147139); only the alpha subunit is glycosylated.[supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

6507-IL/CF
Species: Hu
NB7343
Species: Ca
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-31807
Species: Hu
Applications: IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-45041
Species: Hu, Po
Applications: Flow, IHC-Fr, IF
NBP1-44643
Species: Hu
Applications: Flow, ICC/IF, CyTOF-ready, ICC
NB100-56722
Species: Hu, Mu, Rt, Ca
Applications: WB, DB, ELISA, Flow, Func, ICC/IF, IP, In vitro, B/N, Flow-CS
NBP1-47492
Species: Hu, Bb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
8415-A2
Species: Mu
NBP2-16456
Species: Hu
Applications: WB, IHC, IHC-P
AF123
Species: Hu
Applications: WB, Block, ICC

Publications for Fc epsilon RI Antibody (NBP1-59074) (0)

There are no publications for Fc epsilon RI Antibody (NBP1-59074).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fc epsilon RI Antibody (NBP1-59074) (0)

There are no reviews for Fc epsilon RI Antibody (NBP1-59074). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fc epsilon RI Antibody (NBP1-59074) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Fc epsilon RI Products

Bioinformatics Tool for Fc epsilon RI Antibody (NBP1-59074)

Discover related pathways, diseases and genes to Fc epsilon RI Antibody (NBP1-59074). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fc epsilon RI Antibody (NBP1-59074)

Discover more about diseases related to Fc epsilon RI Antibody (NBP1-59074).
 

Pathways for Fc epsilon RI Antibody (NBP1-59074)

View related products by pathway.

PTMs for Fc epsilon RI Antibody (NBP1-59074)

Learn more about PTMs related to Fc epsilon RI Antibody (NBP1-59074).
 

Research Areas for Fc epsilon RI Antibody (NBP1-59074)

Find related products by research area.

Blogs on Fc epsilon RI

There are no specific blogs for Fc epsilon RI, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fc epsilon RI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCER1A
Uniprot