FBXO7 Antibody (4G8)

Images

 
Immunocytochemistry/ Immunofluorescence: FBXO7 Antibody (4G8) [H00025793-M01] - Analysis of monoclonal antibody to FBXO7 on HeLa cell. Antibody concentration 10 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
4G8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

FBXO7 Antibody (4G8) Summary

Immunogen
FBXO7 (NP_036311, 357 a.a. ~ 455 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AVCRDLFTASNDPLLWRFLYLRDFRDNTVRVQDTDWKELYRKRHIQRKESPKGRFVMLLPSSTHTIPFYPNPLHPRPFPSSRLPPGIIGGEYDQRPTLP
Specificity
FBXO7 (4G8)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FBXO7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for FBXO7 Antibody (4G8)

  • F-box only protein 7
  • F-box protein 7
  • FBX
  • FBX07
  • FBX7
  • FBX7Fbx
  • FBXO7
  • PARK15
  • PARK15DKFZp686B08113
  • PKPS

Background

This gene encodes a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. The protein encoded by this gene belongs to the Fbxs class and it may play a role in regulation of hematopoiesis. Alternatively spliced transcript variants of this gene have been identified with the full-length natures of only some variants being determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41486
Species: Hu, Mu
Applications: WB, Simple Western, IHC
NBP2-46431
Species: Hu, Mu, Rt
Applications: WB
NB300-270
Species: Hu, Mu, Rt, Ch
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, In vitro
BC100-494
Species: Hu, Mu, Rt, Dr, Rb
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PEP-ELISA, PAGE, KD, KO
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-87262
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF1438
Species: Hu
Applications: WB, IHC
NBP2-15365
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-02677
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-76990
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-87976
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80608
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4736
Species: Hu
Applications: WB
AF4078
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
H00025793-M01
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for FBXO7 Antibody (H00025793-M01) (0)

There are no publications for FBXO7 Antibody (H00025793-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FBXO7 Antibody (H00025793-M01) (0)

There are no reviews for FBXO7 Antibody (H00025793-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for FBXO7 Antibody (H00025793-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional FBXO7 Products

Bioinformatics Tool for FBXO7 Antibody (H00025793-M01)

Discover related pathways, diseases and genes to FBXO7 Antibody (H00025793-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FBXO7 Antibody (H00025793-M01)

Discover more about diseases related to FBXO7 Antibody (H00025793-M01).
 

Pathways for FBXO7 Antibody (H00025793-M01)

View related products by pathway.

PTMs for FBXO7 Antibody (H00025793-M01)

Learn more about PTMs related to FBXO7 Antibody (H00025793-M01).

Blogs on FBXO7

There are no specific blogs for FBXO7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FBXO7 Antibody (4G8) and receive a gift card or discount.

Bioinformatics

Gene Symbol FBXO7
Entrez
OMIM
Uniprot